KEGG   Rattus norvegicus (rat): 29225Help
Entry
29225             CDS       T01003                                 

Gene name
Ces1e, Ces1, Es22
Definition
carboxylesterase 1E (EC:3.1.1.1)
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    29225 (Ces1e)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     29225 (Ces1e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
19p11
AA seq 561 aa AA seqDB search
MCLYALILVFLAAFTAGGHPSSLPVVDTLQGKVLGKYVSLEGFTQPVAVFLGVPFAKPPL
GSLRFAPPQPAEPWSFVKNTTSYPPMCSQDPVAGQIVNDLLTNREENISLQFSEDCLYLN
IYTPADLTKRDRLPVMVWIHGGGLVLGGASTYDGLALSTHENVVVVVIQYRLGIWGFFST
GDEHSRGNWGHLDQVAALHWVQDNIDNFGGDPGSVTIFGESAGGESVSVLVLSPLAKNLF
HKAISESGVALTAGLVKKNTRPLAEKIAVVSGCKSTTSAAMVHCLRQKTEEELLETTLKL
NLFSLDLHGDSRQSYPFVPTVLDGVVLPKMPEEILAEKDFNTVPYIVGINKQEFGWILPT
MMNYPPSDMKLDPMTATSLLKKSSFLLNLPEEAIPVAVEKYLRHTDDPDRNKDQLLELIG
DVIFGVPSVIVSRGHRDAGARTYMYEFQYRPSFSSKMKPSTVVGDHGDEIYSVFGAPILR
GGTSKEEINLSKMMMKFWANFARNGNPNGQGLPHWPEYDQKEGYLQIGATTQQAQKLKEK
EVAFWSELLAMKPLHAGHTEL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctctatgctctgatcctggtgtttcttgcagcattcacagcagggggacaccca
tcgtcactacccgtagtggacaccctgcaaggcaaagtcctcgggaagtacgtcagctta
gaaggattcacacagcctgtggccgtcttcctgggagtcccctttgccaagccccctctc
ggatctctgaggtttgctccaccacagcctgcagagccctggagcttcgtaaagaacacc
acctcctaccctcctatgtgctcccaagaccccgtggcagggcaaatagtcaatgacctt
ctaactaaccgggaagagaacatttctctccagttttctgaagactgtctctacctaaat
atttacacgcctgctgacttgacaaaacgtgatagactgccggtgatggtgtggatccat
ggaggtggactagtgttaggtggggcatccacctatgatggactagccctgtctactcat
gaaaatgtggtggtagtggtcattcaataccgtctgggtatttggggattcttcagcaca
ggggatgaacacagccggggcaactggggtcacttggaccaggtggctgcactgcactgg
gtccaggacaacattgacaactttggaggggacccaggctctgtgaccatctttggagag
tcagcaggaggtgaaagtgtctctgttcttgtgttgtctcccttggccaagaatctcttt
cacaaggccatttccgaaagtggcgtggccctcactgcaggcctggtcaagaagaacacc
aggcccttggctgagaaaattgctgttgtatctggttgtaaaagcacaacttcagctgcc
atggttcactgccttcgccagaagacagaggaagagctcttggagaccacactaaaattg
aatcttttttcgctggatttgcacggagactccaggcagagctatccgtttgttcccact
gtgcttgatggagtggtgctgccaaagatgcctgaggagatcctggctgagaaggacttc
aacactgtgccctacatcgtgggaatcaacaagcaagagtttggctggattctgccaaca
atgatgaactatccaccctctgatatgaaattggacccgatgacagccacatcgctcttg
aagaagtcttcttttcttcttaaccttcctgaagaagcaattccagtggccgttgagaag
tatttaagacacacagatgacccagacagaaataaagaccaacttctggaattgattggg
gatgtgatcttcggtgtcccatcagtgattgtctcccgtggacatagagatgctggagcc
cgcacatacatgtacgagtttcaatatcgcccaagcttctcatcaaaaatgaaaccaagt
acggtggtaggagatcatggagacgaaatctactctgtctttggtgctccaattttaaga
ggtggtacctcaaaagaggagatcaatctcagcaagatgatgatgaaattctgggcaaac
tttgctaggaatgggaatcccaatggacagggcctgccccattggccagagtatgaccaa
aaggaaggttatcttcagattggagccaccactcaacaagcccagaagctaaaagaaaaa
gaagtggctttctggtctgagcttctggctatgaagccactgcatgcaggacacactgag
ctatga

DBGET integrated database retrieval system