KEGG   Rattus norvegicus (rat): 292406Help
Entry
292406            CDS       T01003                                 

Gene name
Thbs2, TSP-2
Definition
thrombospondin 2
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
rno  Rattus norvegicus (rat)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    292406 (Thbs2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    292406 (Thbs2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    292406 (Thbs2)
  Cellular commiunity
   04510 Focal adhesion
    292406 (Thbs2)
 Human Diseases
  Infectious diseases
   05144 Malaria
    292406 (Thbs2)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   292406 (Thbs2)
  Exosomal proteins of colorectal cancer cells
   292406 (Thbs2)
  Exosomal proteins of bladder cancer cells
   292406 (Thbs2)
Heparan sulfate/heparin binding proteins [BR:rno00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  292406 (Thbs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q12
AA seq 1172 aa AA seqDB search
MLWALALLALGIGPRAYAGDHGEDTAFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYVPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGP
GDTLDLNYWVEGHQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFY
EQLEADKSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGAEVNTISEH
TETLHLSPHITTDLVVQGVEKAQEVCTHSCEELSNMMNELSGLHVMVNQLSKNLERVSSD
NQFLLELIGGPLKTRNMSACVQEGRIFAENETWVVDSCTTCTCKKFKTVCNQITCSPATC
ANPSLVEGECCPSCSHSADNDEGWSPWAEWTECSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRTCSLGKCDTRIRQNGGWSHWSPWSSCSVTCGVGNVTRIRLCNSPVPQMGGKNCKGSG
RETKACQRAPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKDCVGDVTEH
QMCNKRSCPIDGCLSNPCFPGAKCNSFPDGSWSCGSCPVGFLGNGTHCEDLDECAVVADI
CFSINKASRCVNTNPGFHCLPCPPRYKGTQPFGIGLEDAKTEKQVCEPENPCKDKTHNCH
KHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNSNLVCATNATYHCVKDNC
PKLPNSGQEDFDKDGIGDACDEDDDNDGVSDEKDNCPLLFNPRQLDYDKDEVGDRCDNCP
YVHNQAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
MHNPDQMDQDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNSNQADHDNDGKGDACDSDD
DNDGVPDDRDNCRLVFNPDQEDSDGDGRGDICKDDFDNDNVPDIDDVCPENNAITETDFR
NFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDKPSRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTEGQVRTLWHDPKNIGWKDYTAYRWHLIHRPKTGYMRVLVHEGKQVMADSGPI
YDQTYAGGRLGLFVFSQEMVYFSDLKYECRDA
NT seq 3519 nt NT seq  +upstreamnt  +downstreamnt
atgctctgggcactggccctgctggctctgggcatagggccaagagcttacgctggtgac
cacggcgaggacacagcatttgaccttttcagcatcagcaacattaaccggaagaccatc
ggtgccaagcagttccgagggcccgaccccggtgtgcccgcctaccgttttgtccggttt
gactacgtccccccagtgaatacagacgacctcaacaggatcgttaagcttgcaaggaga
aaggagggcttcttcctcacagcccagctgaagcaggaccgcaagtctcggggaacactc
ctggtgttggaaggtcccggcacctcccagaggcagtttgagattgtgtccaatggccca
ggggataccttggacctcaactactgggtagaaggccaccagcataccaacttcctggag
gatgtgggtctggctgactcccagtggaagaatgtgactgtgcaggtggccagtgacacc
tatagcctgtatgtgggctgtgatcttattgacagtgtcaccctggaagaacccttctat
gagcagctggaagcagacaagagcaggatgtacgtggccaagggtgcatctcgagagagt
cacttcaggggcttgctgcagaatgtccatctcgtgtttgcagattctgtggaagatatt
ctaagcaagaaaggctgtcaacacagccagggagctgaagtcaacaccatcagtgaacat
acagagacactccacctgagccctcacatcaccacagatctggtggtccagggtgtggag
aaggcacaggaggtgtgtacgcactcctgtgaagagctgagcaacatgatgaacgagctg
tccggattgcacgtcatggtgaaccagctgagcaagaacctggagagagtgtctagcgat
aaccagttccttttggagctcattgggggccctctgaagacaagaaacatgtcggcctgt
gtgcaggagggacggatctttgcagaaaacgaaacctgggttgtggatagttgtaccacc
tgcacctgcaagaaatttaaaacagtctgcaatcaaatcacctgctcacctgcaacttgt
gccaacccatctttggtggaaggcgagtgctgtccatcctgttcccactctgcagacaac
gatgagggctggtctccgtgggcagagtggaccgagtgttctgtcacctgtggctctggg
acccagcagagaggccggtcttgtgatgtcaccagcaacacctgcctgggcccctccatt
cagacaaggacatgcagtttgggcaaatgtgatacgagaatccgtcagaatggaggctgg
agtcactggtcaccctggtcttcgtgctccgtgacttgtggagttggcaatgtcacccgc
atacgtctctgcaactcaccagtgccccaaatgggtggcaagaactgcaagggcagtggc
cgggaaaccaaggcctgccagcgtgctccatgcccaattgatggccgctggagcccctgg
tccccttggtcagcctgcacagttacctgtgctggagggatccgtgagcgcacacgtgtt
tgcaacagccctgagccccagtatggagggaaggattgtgtcggggatgtgacagaacac
caaatgtgcaacaagaggagctgccctattgatggatgcctatccaacccgtgtttccct
ggagccaagtgcaacagcttccccgatggctcctggtcctgtggttcctgcccagtgggc
tttctgggcaatggcacccactgtgaggacctggatgagtgtgctgtggtcgcagatatc
tgcttctcaattaacaaagcttcccgctgtgtcaacaccaaccctggcttccactgcctg
ccttgtccgccacgctacaaggggacccaacccttcgggattggcctggaggatgctaaa
acagaaaaacaagtatgtgagccagagaatccgtgcaaggacaagactcacaactgccac
aagcatgcagagtgcatctacctgggccacttcagtgaccccatgtacaagtgcgagtgc
cagactggctatgcaggtgatgggctcatctgcggggaggactcagacctggacggttgg
cccaacagcaacctggtgtgtgctaccaatgccacctaccactgcgtcaaggacaactgc
cccaaactgccaaattctgggcaggaggattttgataaggacggaatcggagatgcttgc
gacgaggacgatgataacgacggcgtgagcgatgagaaggacaattgcccacttctcttc
aatccccgccaattagactatgataaggatgaggttggagaccgctgtgacaattgcccc
tatgtgcacaaccaagcacagatcgacacggacaacaacggtgaaggggacgcctgctct
gtggatatcgacggggatgatgttttcaatgagcgagacaattgcccgtatgtctacaac
actgaccagagagacacagacggtgacggcgttggggaccactgtgacaactgtcctctg
atgcataacccagatcagatggatcaggacaatgatctcgttggagaccagtgtgataac
aatgaggacatagatgatgacggccaccagaacaaccaagacaactgcccatacatctcc
aactccaaccaggctgaccatgacaatgacggcaagggggatgcctgtgactccgatgat
gacaacgatggtgttccagatgacagggacaactgcaggcttgtgttcaaccccgaccag
gaagactcggatggcgacggccgaggtgatatttgtaaagatgactttgacaatgataat
gtcccagatattgatgacgtgtgccccgagaacaatgccatcaccgagacagacttcaga
aactttcagatggtccctctggatcccaaggggaccacacaaattgatcccaactgggta
attcgtcaccaaggcaaagagctggtgcagacagcaaactcggaccctggcatcgccgta
ggtttcgatgagtttgggtctgtggacttcagcggcactttctatgtcaacactgaccgg
gacgatgactacgccggcttcgtctttggctatcagtcaagcagccgcttctatgtggtg
atgtggaagcaggtgacccagacctactgggaagacaagcccagtcgggcttacggctac
tctggtgtgtcactcaaagtagtaaactccacgactggtactggcgagcacctgaggaat
gccctgtggcacacgggaaacacggaaggccaggttcgaactctatggcatgaccccaaa
aacattggctggaaggactacaccgcctacaggtggcatctgattcacaggcctaagaca
ggctacatgagagtcttagtgcatgaaggaaagcaggtcatggctgactcaggaccaatt
tatgaccaaacttatgctggtggacggctgggtctgtttgtcttctcccaagaaatggtc
tacttctcagacctcaagtatgagtgcagagatgcctag

DBGET integrated database retrieval system