KEGG   Rattus norvegicus (rat): 29244Help
Entry
29244             CDS       T01003                                 

Gene name
Gch1, Gch
Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rno00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
15p14
AA seq 241 aa AA seqDB search
MEKPRGVRCTNGFPERELPRPGASRPAEKSRPPEAKGAQPADAWKAGRPRSEEDNELNLP
NLAAAYSSILRSLGEDPQRQGLLKTPWRAATAMQFFTKGYQETISDVLNDAIFDEDHDEM
VIVKDIDMFSMCEHHLVPFVGRVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQI
AVAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIR
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggagaagccgcggggtgtaaggtgcaccaatgggttccccgagcgggagctgccgcgg
cccggggccagccgacctgccgagaagtcccggccgcccgaggccaagggcgcacagcca
gccgacgcctggaaggcagggcggccccgcagcgaggaggataacgagctgaacctcccc
aacctggcggccgcttactcgtccatcctgcgctcgctgggcgaggacccccagcggcag
gggctgctcaagacgccctggagggcggccaccgccatgcagttcttcaccaagggatac
caggagaccatctcagatgtcctgaacgatgctatatttgatgaggaccatgacgagatg
gtgattgtgaaggacattgacatgttttccatgtgtgagcatcacctggtcccatttgtg
ggaagggtccatattggttatcttcctaacaagcaagtccttggtctcagcaaacttgcc
aggattgtggaaatctacagtagaagactacaagttcaagaacgccttaccaaacagatt
gcagtggccatcacagaagccttgcagcctgctggcgtcggggtagtgattgaagcaaca
cacatgtgtatggtcatgcgaggtgtgcagaaaatgaacagcaagactgtcactagcacc
atgctaggcgtgttccgggaagacccaaagactcgggaggagttcctcacactcatcagg
agctga

DBGET integrated database retrieval system