KEGG   Rattus norvegicus (rat): 29254Help
Entry
29254             CDS       T01003                                 

Gene name
Mgll, MAGL
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycerolipid metabolism
Metabolic pathways
Thermogenesis
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    29254 (Mgll)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    29254 (Mgll)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    29254 (Mgll)
  Environmental adaptation
   04714 Thermogenesis
    29254 (Mgll)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     29254 (Mgll)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S33
   29254 (Mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q34
AA seq 303 aa AA seqDB search
MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDE
LAQMLKRLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDLLQHVNTVQKDYPEVPVFLLG
HSMGGAISILAAAERPTHFSGMILISPLILANPESASTLKVLAAKLLNFVLPNISLGRID
SSVLSRNKSEVDLYNSDPLICHAGVKVCFGIQLLNAVSRVERAMPRLTLPFLLLQGSADR
LCDSKGAYLLMESSPSQDKTLKMYEGAYHVLHKELPEVTNSVLHEINTWVSHRIAVAGAR
CLP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggcaagttcacccaggcgaactccacagaacgtcccctaccaggaccttcct
cacctggtcaatgcggatggacagtacctcttttgtaggtactggaagcccagtggcaca
cccaaggccctcatcttcgtgtcccatggagctggggaacactgtggccgttatgacgag
ctggctcagatgttgaagaggctggacatgctggtgtttgcccatgaccatgttggccat
gggcagagcgagggagagaggatggtggtatcggacttccaagtttttgtcagagatttg
ttgcagcacgtgaacaccgtccagaaggactaccccgaggtccccgtcttcctcctgggc
cactccatgggcggtgccatctccatcctagcagctgcagagagaccaacccacttttct
ggcatgatcctaatttcacctctgatccttgccaatccggaatctgcatcgactttgaag
gtccttgctgccaaactgctcaattttgtcctgccaaacatatccttggggcgcatcgac
tccagcgtgctgtctcggaacaagtcggaggttgacctgtacaactccgacccactcatc
tgccacgcaggggtgaaggtatgctttggcatccagctgctgaacgctgtctcgagggtg
gagcgagcaatgcccaggctgacactgccgttcctgctgctgcagggttctgctgaccgg
ctttgcgacagcaaaggtgcctacctgctcatggaatcatccccgagtcaggacaaaaca
ctcaagatgtatgaaggtgcctaccatgttctccacaaggagcttccggaagtgaccaac
tctgtcctccatgaaataaatacgtgggtgtctcacaggatagcagtggcaggagctagg
tgtctaccctga

DBGET integrated database retrieval system