KEGG   Rattus norvegicus (rat): 292728Help
Entry
292728            CDS       T01003                                 

Gene name
Cyp2b21, Cyp2b13
Definition
cytochrome P450, family 2, subfamily b, polypeptide 21
Orthology
K07412  
cytochrome P450, family 2, subfamily B [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    292728 (Cyp2b21)
   00590 Arachidonic acid metabolism
    292728 (Cyp2b21)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    292728 (Cyp2b21)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    292728 (Cyp2b21)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     292728 (Cyp2b21)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   292728 (Cyp2b21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q21
AA seq 494 aa AA seqDB search
MDPSVLLLFALLTGFLLLLIRGQGNGYGHLPPGPCPLPLLGNVLQMDRRGLLKSFIQLRD
KYGDVVTVHLGPRPIVMLYGTETIREALVDHAEAFSGRGTVAVVQPIIQDYGMIFANGER
WKILRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYKGAPLDPTFHLQCITANIIC
SIVFGERFDYTDHQFLHLLDLFYEILSLVSSFSSQVFELFTGFLKYFPGTHRHISKNIEE
ILNFIGHCVEKHRATLDPSTPRDFIDTYLLRMEKEKLNHHTEFHHQNLMMSVLSLFFAGT
ETSSTTLRYGFLLMLKYPHVAEKVQKEIDQVIGSHRVPTLDDRIKMPYTDAVIHEIQRFS
DLVPIGLPHRVTKDTLFRGYLLPKNIEVYPILSSALHDPQYFEHPDTFNPEHFLDANGAL
KKNEAFLPFSTGKRVCLGEGIARNELFLFFTTILQNFSVSSPVSPKDIDLTPKESGFAKI
PPTYQICFLSRQLG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggatcccagtgtcctgctcctttttgctcttctcacaggcttcttgctactcttgatc
aggggccagggaaacggatatggccatcttccaccaggaccctgtcccctgcccctcttg
gggaacgttttgcaaatggacagaagaggtctcctcaagtcttttattcagcttcgtgac
aaatatggagatgtggttacagtgcacttgggaccaaggcccatagtcatgctgtatggg
accgagaccataagggaagctctggtggaccatgctgaggctttctctggccggggaaca
gttgctgtggttcagccaattatacaggactatggtatgatctttgccaatggggaacgt
tggaagatccttcggcgattctctctagccaccatgagagactttgggatgggaaagcga
agtgtggaggagaggataaaggaggaggcccaatgtttggtggaggaactgaagaaatac
aagggagccccactggaccccaccttccacctacagtgcattacagccaacatcatctgc
tccattgtctttggagaacgttttgactacacagaccaccagtttctgcacctgctcgac
ctgttctatgagatcttgtcacttgttagctcattctccagccaggtgtttgagcttttc
actggcttcctgaagtactttcctggcacccacagacacatctccaaaaacatagaggaa
atcctcaacttcattggccattgtgtggagaagcacagggccacattagaccccagcact
ccacgagacttcatagatacctaccttctcagaatggagaaggagaaattaaaccaccac
acagaattccatcaccagaacctcatgatgtctgtgctctctctcttctttgctggcact
gagaccagcagcaccacacttcgctatggtttcctgctcatgctcaagtacccccatgtt
gcagagaaagttcaaaaggagattgatcaggtgattggctcacaccgggtcccaaccctt
gatgaccgcatcaaaatgccatacactgatgcagtcatccatgagattcagagattttca
gatcttgtcccgattggtctgccacacagagtcaccaaagacacattgttccgagggtac
ctgctccccaagaacattgaggtgtaccccatcctgagttcagcactccatgatccacag
tactttgaacacccggacaccttcaatcctgagcacttcctggatgccaatggggcactg
aagaagaatgaagcttttctgcccttctccacaggaaagcgtgtttgtcttggtgaaggc
attgcccgcaatgagttgttccttttcttcacaaccatcctccagaacttctcagtgtcc
agccctgtgtctcctaaggacattgatctcactcccaaggagagtggctttgccaaaata
cctccaacataccagatctgcttcttatctcgccaattgggctga

DBGET integrated database retrieval system