KEGG   Rattus norvegicus (rat): 292788Help
Entry
292788            CDS       T01003                                 

Gene name
Psenen, RGD1312037
Definition
presenilin enhancer gamma secretase subunit
Orthology
K06170  
presenilin enhancer 2
Organism
rno  Rattus norvegicus (rat)
Pathway
Notch signaling pathway
Alzheimer's disease
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:rno04330]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:rno05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q21
AA seq 101 aa AA seqDB search
MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFKEAFFAPAYTEQSQIKGYVWRS
AVGFLFWVIVLTTWITIFQIYRPRWGALGDYLSFTIPLGTP
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgaacttagagcgggtgtccaatgaggagaagttgaacctgtgccggaagtactatctt
ggtggatttgcatttctgccttttctttggttggtcaacattttctggttcttcaaagag
gccttcttcgctccagcctacacagagcagagccaaatcaaaggctatgtttggcgctca
gctgtgggcttcctcttctgggtgattgttctcaccacctggatcaccatcttccagatc
taccggccccgctggggtgctcttggggactacctctccttcaccattcccctgggcact
ccctga

DBGET integrated database retrieval system