KEGG   Rattus norvegicus (rat): 292788Help
Entry
292788            CDS       T01003                                 

Gene name
Psenen, RGD1312037
Definition
presenilin enhancer gamma secretase subunit
Orthology
K06170  
presenilin enhancer 2
Organism
rno  Rattus norvegicus (rat)
Pathway
Notch signaling pathway
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    292788 (Psenen)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    292788 (Psenen)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q21
AA seq 101 aa AA seqDB search
MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFKEAFFAPAYTEQSQIKGYVWRS
AVGFLFWVIVLTTWITIFQIYRPRWGALGDYLSFTIPLGTP
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgaacttagagcgggtgtccaatgaggagaagttgaacctgtgccggaagtactatctt
ggtggatttgcatttctgccttttctttggttggtcaacattttctggttcttcaaagag
gccttcttcgctccagcctacacagagcagagccaaatcaaaggctatgtttggcgctca
gctgtgggcttcctcttctgggtgattgttctcaccacctggatcaccatcttccagatc
taccggccccgctggggtgctcttggggactacctctccttcaccattcccctgggcact
ccctga

DBGET integrated database retrieval system