KEGG   Rattus norvegicus (rat): 292876Help
Entry
292876            CDS       T01003                                 

Gene name
Josd2, RGD1307305
Definition
Josephin domain containing 2 (EC:3.4.19.12)
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q22
AA seq 188 aa AA seqDB search
MSQAPEARPRSPSVYHERQRLELCAVHALNNVLQEQLFSQEAADEICKRLAPDSRLNPHR
SLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLVLPQVLGLILNLPSPVSLGLLSLP
LRRRHWVALRQVDGIYYNLDSKLRAPEALGGEDGVRAFLAAALAQGLCEVLLVVTKEVEE
AGCWLHTS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggcgccggaagcgagaccaagatcaccctcagtgtatcacgagcggcagcgg
ctagagctgtgtgccgttcatgctctcaacaacgtcctccaagagcagctctttagccag
gaagctgccgacgaaatctgcaagaggctagccccagattcccggctgaacccccatcgc
agtctcttgggcaccggcaactatgatgtcaacgtgatcatggctgccctgcagggcctg
ggcctggccgctgtgtggtgggacaggaggagacccctgtcccagctggtcctgccccag
gtactaggcctgatcttgaacctaccctctcctgtgtcgctggggctgctgtccctgccg
ctgcgccggcgacactgggtggccctgcgccaggtggacggcatctactataatctggac
tcaaagctacgggcacctgaagccctggggggcgaggatggtgtcagagccttcctggca
gctgccttggctcaaggcctgtgcgaggtgctattggtggtgaccaaggaggtggaggag
gctggctgctggctgcacacaagctga

DBGET integrated database retrieval system