KEGG   Rattus norvegicus (rat): 292876Help
Entry
292876            CDS       T01003                                 

Gene name
Josd2, RGD1307305
Definition
Josephin domain containing 2 (EC:3.4.19.12)
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     292876 (Josd2)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C86
   292876 (Josd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q22
AA seq 188 aa AA seqDB search
MSQAPEARPRSPSVYHERQRLELCAVHALNNVLQEQLFSQEAADEICKRLAPDSRLNPHR
SLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLVLPQVLGLILNLPSPVSLGLLSLP
LRRRHWVALRQVDGIYYNLDSKLRAPEALGGEDGVRAFLAAALAQGLCEVLLVVTKEVEE
AGCWLHTS
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggcgccggaagcgagaccaagatcaccctcagtgtatcacgagcggcagcgg
ctagagctgtgtgccgttcatgctctcaacaacgtcctccaagagcagctctttagccag
gaagctgccgacgaaatctgcaagaggctagccccagattcccggctgaacccccatcgc
agtctcttgggcaccggcaactatgatgtcaacgtgatcatggctgccctgcagggcctg
ggcctggccgctgtgtggtgggacaggaggagacccctgtcccagctggtcctgccccag
gtactaggcctgatcttgaacctaccctctcctgtgtcgctggggctgctgtccctgccg
ctgcgccggcgacactgggtggccctgcgccaggtggacggcatctactataatctggac
tcaaagctacgggcacctgaagccctggggggcgaggatggtgtcagagccttcctggca
gctgccttggctcaaggcctgtgcgaggtgctattggtggtgaccaaggaggtggaggag
gctggctgctggctgcacacaagctga

DBGET integrated database retrieval system