KEGG   Rattus norvegicus (rat): 29295Help
Entry
29295             CDS       T01003                                 

Gene name
Cyp2b12, Cyp2b15
Definition
(RefSeq) cytochrome P450, family 2, subfamily b, polypeptide 12
  KO
K07412  cytochrome P450 family 2 subfamily B [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno00590  Arachidonic acid metabolism
rno00830  Retinol metabolism
rno01100  Metabolic pathways
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    29295 (Cyp2b12)
   00590 Arachidonic acid metabolism
    29295 (Cyp2b12)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    29295 (Cyp2b12)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    29295 (Cyp2b12)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     29295 (Cyp2b12)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   29295 (Cyp2b12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 29295
NCBI-ProteinID: NP_058852
RGD: 620088
Ensembl: ENSRNOG00000031529
UniProt: P33272
Position
1q21
AA seq 492 aa AA seqDB search
MEFGVLLLLTLTVGFLLFLVSQSQPKTHGHLPPGPRPLPFLGNLLQMNRRGFLNSFMQLQ
EKYGDVFTVHLGPRPVVILCGTDTIREALVDQAEAFSGRGTVAVLHPVVQGYGVIFATGE
RWKTLRRFSLVTMKEFGMGKRSVDERIKEEAQCLVEELKKYKGAPLNPTFLFQSIAANTI
CSIVFGERFDYKDHQFLHLLDLVYKTSVLMGSLSSQVFELYSGFLKYFPGAHKQIFKNLQ
EMLNYIGHIVEKHRATLDPSAPRDFIDTYLLRMEKEKSNHHTEFNHQNLVISVLSLFFAG
TETTSTTLRCTFLIMLKYPHVAEKVQKEIDQVIGSHRLPTPDDRTKMPYTDAVIHEIQRF
ADLTPIGLPHRVTKDTVFRGYLLPKNTEVYPILSSALHDPRYFEQPDTFNPEHFLDANGA
LKKSEAFLPFSTGKRICLGEGIARNELFIFFTAILQNFTLASPVAPEDIDLTPINIGVGK
IPSPYQINFLSR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggaattcggtgtcttgctcctcctcactctcactgtgggcttcttgctattcttagtc
agccaaagtcagccaaagacccatgggcacttgccaccaggacctcgtcccctgcccttc
ttggggaacctcttacagatgaacagaagaggctttctgaattctttcatgcagcttcaa
gaaaaatatggagatgtgttcacagtacacctgggaccaaggcccgtggtcatattgtgt
gggacagacaccataagagaggctctggtggaccaagctgaagctttctctggtcgggga
acagttgctgtgctccatccagttgtacagggatatggtgtgatctttgccactggggaa
cgttggaagacccttcggcgattctctctggtcaccatgaaagaattcggaatgggaaag
cggagtgtagatgagaggataaaggaggaggcccagtgtttggtggaggagctgaagaaa
tacaagggagcccccctgaaccccaccttcctcttccaatccatcgcagcaaacaccatc
tgctccattgtctttggagagcgctttgactacaaagaccaccagttcctgcatctgctg
gatctagtctataagacatctgtccttatgggctccttgtccagccaggtgtttgagctt
tactctggcttcctgaaatactttcctggtgcccacaaacaaatcttcaaaaacctacag
gaaatgctcaactacattggccatattgtggagaagcacagggcaaccttggaccccagt
gctccacgagatttcatcgatacttaccttctgcgcatggagaaggagaagtccaaccat
cacacagagttcaatcaccagaaccttgtgatctctgtgctctctctcttctttgctggc
accgagaccaccagcaccacgctccgttgcaccttcctgatcatgctcaagtacccccac
gttgcagagaaagtccaaaaggagattgatcaggtgattggctcacaccggctaccaacc
cctgatgatcgtaccaaaatgccatatactgatgcagtcatccatgagattcagagattt
gcagatctgaccccgattggtctaccacacagagtcaccaaagacaccgtgttccgaggg
tacctgcttcccaagaacactgaggtgtaccccatcctgagttcagctctccatgaccca
cggtactttgaacaaccagacactttcaatcctgagcacttcctggatgccaatggggca
ctgaagaagagtgaagcttttctgcccttctctacaggaaagcgcatttgtcttggagaa
ggcattgcccgaaatgaattgttcattttcttcaccgccatcctgcagaacttcactttg
gcaagccctgtggctcctgaggacattgacctcactcccattaacattggtgtaggcaaa
ataccctctccataccagataaacttcctgtcccgttga

DBGET integrated database retrieval system