KEGG   Rattus norvegicus (rat): 293152Help
Entry
293152            CDS       T01003                                 

Gene name
Art2b, ARTC2, Ag-F, Art2, Art2a, LY2, Ly-2, PtaA, RT6.1, RT6.2, Rt6
Definition
ADP-ribosyltransferase 2b (EC:2.4.2.31)
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     293152 (Art2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32
AA seq 275 aa AA seqDB search
MPSNICKFFLTWWLIQQVTGLTGPLMLDTAPNAFDDQYEGCVNKMEEKAPLLLQEDFNMN
AKLKVAWEEAKKRWNNIKPSRSYPKGFNDFHGTALVAYTGSIAVDFNRAVREFKENPGQF
HYKAFHYYLTRALQLLSNGDCHSVYRGTKTRFHYTGAGSVRFGQFTSSSLSKKVAQSQEF
FSDHGTLFIIKTCLGVYIKEFSFRPDQEEVLIPGYEVYQKVRTQGYNEIFLDSPKRKKSN
YNCLYSSAGARESCVSLFLVVLPSLLVQLLCLAEP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaaatatttgcaagttcttcctaacttggtggttaattcagcaggtgactggg
ctgacagggcctttgatgctagacacggctcccaatgcatttgatgaccagtatgagggc
tgtgtcaacaaaatggaggaaaaggcacccctgcttttacaggaagactttaatatgaat
gcgaaattaaaagttgcgtgggaagaggcaaagaaacgatggaacaacataaaacctagt
aggagttatcccaaaggtttcaatgatttccatggaacggctttagttgcctacactggg
agtatcgctgtagattttaacagagctgttagggaattcaaggaaaatcctggtcaattc
cactacaaggccttccattactacttaacaagagctcttcagcttttgagtaacggggat
tgtcattcagtctaccgaggcactaagaccaggtttcactatactggagctggctccgtg
cgattcgggcagttcacgtcttcatctttatctaagaaagtagctcaatctcaagagttt
ttcagtgatcatgggacgctgttcatcatcaaaacctgcttgggggtttatatcaaagaa
ttctctttccgtcctgaccaagaggaggtgttaattccaggctatgaggtatatcagaaa
gtcaggacacaaggctacaacgaaattttcctggactccccgaagaggaagaagagcaac
tacaattgcttatacagcagcgcaggagccagagagagctgtgtatccctgttccttgtg
gttctccccagtcttctggtccagctgctttgtcttgctgagccgtag

DBGET integrated database retrieval system