KEGG   Rattus norvegicus (rat): 293152Help
Entry
293152            CDS       T01003                                 

Gene name
Art2b, ARTC2, Ag-F, Art2, Art2a, LY2, Ly-2, PtaA, RT6.1, RT6.2, Rt6
Definition
(RefSeq) ADP-ribosyltransferase 2b (EC:2.4.2.31 3.2.2.5)
  KO
K19980  
ADP-ribosyltransferase 2 / NAD+ glycohydrolase [EC:2.4.2.31 3.2.2.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    293152 (Art2b)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     293152 (Art2b)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.5  NAD+ glycohydrolase
     293152 (Art2b)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Enzymes
  293152 (Art2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32
AA seq 275 aa AA seqDB search
MPSNICKFFLTWWLIQQVTGLTGPLMLDTAPNAFDDQYEGCVNKMEEKAPLLLQEDFNMN
AKLKVAWEEAKKRWNNIKPSRSYPKGFNDFHGTALVAYTGSIAVDFNRAVREFKENPGQF
HYKAFHYYLTRALQLLSNGDCHSVYRGTKTRFHYTGAGSVRFGQFTSSSLSKKVAQSQEF
FSDHGTLFIIKTCLGVYIKEFSFRPDQEEVLIPGYEVYQKVRTQGYNEIFLDSPKRKKSN
YNCLYSSAGARESCVSLFLVVLPSLLVQLLCLAEP
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaaatatttgcaagttcttcctaacttggtggttaattcagcaggtgactggg
ctgacagggcctttgatgctagacacggctcccaatgcatttgatgaccagtatgagggc
tgtgtcaacaaaatggaggaaaaggcacccctgcttttacaggaagactttaatatgaat
gcgaaattaaaagttgcgtgggaagaggcaaagaaacgatggaacaacataaaacctagt
aggagttatcccaaaggtttcaatgatttccatggaacggctttagttgcctacactggg
agtatcgctgtagattttaacagagctgttagggaattcaaggaaaatcctggtcaattc
cactacaaggccttccattactacttaacaagagctcttcagcttttgagtaacggggat
tgtcattcagtctaccgaggcactaagaccaggtttcactatactggagctggctccgtg
cgattcgggcagttcacgtcttcatctttatctaagaaagtagctcaatctcaagagttt
ttcagtgatcatgggacgctgttcatcatcaaaacctgcttgggggtttatatcaaagaa
ttctctttccgtcctgaccaagaggaggtgttaattccaggctatgaggtatatcagaaa
gtcaggacacaaggctacaacgaaattttcctggactccccgaagaggaagaagagcaac
tacaattgcttatacagcagcgcaggagccagagagagctgtgtatccctgttccttgtg
gttctccccagtcttctggtccagctgctttgtcttgctgagccgtag

DBGET integrated database retrieval system