KEGG   Rattus norvegicus (rat): 29326Help
Entry
29326             CDS       T01003                                 

Gene name
Gpx2, GPX-GI, GSHPx-2, GSHPx-GI
Definition
glutathione peroxidase 2 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    29326 (Gpx2)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    29326 (Gpx2)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    29326 (Gpx2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     29326 (Gpx2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
6q24
AA seq 190 aa AA seqDB search
MAYIAKSFYDLSAIGLDGEKIDFNTFRGRAVLIENVASLUGTTTRDYTQLNELQCRFPRR
LVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGFQPTFSLTQKCDVNGQNQHPVFAYLK
DKLPYPYDDPFSLMTDPKLIIWSPVRRSDVSWNFEKFLIGPEGEPFRRYSRTFQTINIEP
DIKRLLKVAI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcttacatcgccaagtctttttacgatctcagtgccatcggcctggatggggagaag
atagacttcaacacgttccgaggcagggccgtgctgattgagaatgtggcctcgctctga
ggaacaactacccgggactacacccagctcaatgagttgcagtgccgctttcccaggcgc
ctagtggttctcggcttcccttgcaaccagttcggacatcaggagaactgtcagaatgag
gagatcctgaacagcctcaagtatgtccgccctgggggtgggttccagcccaccttcagt
cttacccaaaagtgtgatgtcaatgggcagaatcagcatcctgtctttgcctacctgaaa
gacaagctgccctacccttatgacgacccattctccctcatgaccgatcccaagctcatc
atatggagtccggtgcgccgctcagatgtgtcctggaactttgagaagttcctcataggg
ccagaaggggagcctttccgtcgctacagccgcaccttccagaccatcaacatcgagcct
gacatcaaacgtctcctcaaagttgccatctaa

DBGET integrated database retrieval system