KEGG   Rattus norvegicus (rat): 293310Help
Entry
293310            CDS       T01003                                 

Gene name
Usp17l5, RGD1562061
Definition
ubiquitin specific peptidase 17-like 5
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     293310 (Usp17l5)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   293310 (Usp17l5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
1q33
AA seq 504 aa AA seqDB search
MVTAPTFTEEDPAMSPPATPELHQDEAQVLEELSAKGKPSLSLQRLQRPGSGLQNIGNSC
YLNAVLQCLTHTPPLADYMLSQEHSQRCCYPEGCNMCAMEAHVTQSLLHSHSGGVMKPSE
ILTSTFHKHRQEDAHEFLMFTLNTMHESCLRGCKQSETTSKDSSLIYDIFGGQMRSQIKC
HHCQGTLDSYDPFLNLFLDICSAQSVKQALEDLVKVEELQGDNAYYCGRCREKMPASKTT
KVQTASKVLLLVLNRSYDFGGDKLNRVVSYPEYLDLQPYLSQPTAGPLPYALYAVLVHDG
VTCSSGHYFCYVKASHGKWYKMDDSKVTRCDVSSVLSEPAYLLFYVQQTDLEKVNVDVSV
GRVHGVLHPESQQKKTRKKKHKRSSCTEAVHMPRENRENTATKETSLGEGKVLQEQNHQK
AGQNLKTTKVNLSANGTVIHQPRYTANWGRNAPDKDNQPGHNGDRLLTTQGSMNTGQLCG
QGGRQRSKKKKNKIKQGQRPLLVY
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggtgactgctcccactttcacagaagaagatccagccatgtcaccacctgctacccca
gagctccatcaggatgaagcacaggtgctagaggagctgtctgccaaggggaagcccagt
ctgagtttgcagaggctccaaagaccagggtccgggctccagaacataggcaacagctgc
tacctgaatgccgtcctgcagtgcttgacacacacaccacctcttgccgactacatgctg
tcccaggagcattctcagaggtgttgttacccagaaggctgtaacatgtgtgctatggaa
gctcatgtgactcagagtctcctccactcccactcaggaggtgtcatgaaaccctccgag
atattgacctctaccttccacaagcacaggcaggaagatgcccatgagtttctcatgttc
accttgaataccatgcatgaatcctgccttcgagggtgcaaacaatcagaaaccacctct
aaggacagctccctgatctatgacatatttggaggccagatgagatctcagatcaagtgt
caccactgccagggcaccttagattcctacgatcccttcctgaacctcttcctggatatc
tgctctgctcagagtgtgaagcaagccttggaggacttagtaaaggtagaagagttgcag
ggggacaacgcctactactgtggtaggtgtagagagaagatgccagcttctaagaccacg
aaggttcagactgcctcaaaggttctcctgctagtgttaaaccgctcctacgatttcggg
ggtgacaagttgaacagggtagtaagctacccagagtaccttgacctgcagccatacctg
tcacagccaactgcaggacccctgccttatgctctctatgccgtcctggtccatgatggg
gtgacttgttccagtggacattacttctgttatgtcaaagccagccatgggaagtggtat
aagatggatgattctaaggtcaccaggtgcgatgtgtcctctgtcctgagcgagcctgcc
tatctgctcttctatgtccagcagactgaccttgagaaggtcaatgttgatgtgtctgtg
ggcagagtacatggggttcttcaccctgaatcccagcagaagaaaacgcggaagaaaaag
cacaagagaagctcttgcacagaagctgtacacatgccccgagaaaacagggaaaataca
gccaccaaagaaacctccttaggggaggggaaagtgcttcaggaacagaaccaccagaaa
gctgggcagaacctcaagactaccaaagtcaatttgtcagccaacggaactgtgattcat
cagcccagatataccgcaaactggggcaggaatgctccagacaaggacaatcaaccaggg
cacaatggtgacagactcctcaccactcagggctccatgaacactgggcaactctgtggt
cagggagggagacaaagatctaagaagaagaagaacaagatcaagcaagggcagaggcct
ctgcttgtttactag

DBGET integrated database retrieval system