KEGG   Rattus norvegicus (rat): 293317Help
Entry
293317            CDS       T01003                                 

Gene name
RGD1565607
Definition
similar to mouse deubiquitinating enzyme 6
Orthology
K11845  
ubiquitin carboxyl-terminal hydrolase 17 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
1q33
AA seq 536 aa AA seqDB search
MSRRNTAIFWRESLPSAHLENSSRLFXDDHRNMVTAHSFTEEDPAMSPPATPELHQDEAR
VLEELSAKGKPSLSLQRIQSPGSGLQNIGNSCYLNAVLQCLTHTPPLADYMLSQEHSQRC
CYPEGCKMCAMEAHVTQSLLHSHSGGVMKPSEILTSTFHKHRQEDAHEFLMFTLNAMHES
CLRGCKQSETSSKDSSLIYDIFGGQMRSQIKCHHCQGTLDSYDPFLNLFLDICSAQSVKQ
ALEDLVKLEELQGDNAYYCGRCREKMPASKTTKVQTASKVLLLVLNRSYDFGGDKLNRVV
SYPEYLDLQPYLSQPTAGPLPYALYAVLVHDGVTCSSGHYFCYVKASHGKWYKMDDSKVT
RCDVSSVLSEPAYLLFYVQQTDLEKVNVDVSVGRVHGVLHPESQQKKTRKKKHKRSSCTE
AVHMPRENRENTATKETSLGEGKVLQEQNHQKAGQNLKTTKVNLSANGTVIHQPRYTANW
GRNAPDKDDQPGHSGDRLLTTQGSMNTGQLCGHGGSQRSKKRKNKNKQGQRPLLVC
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcaggaacacagcgattttctggagggaaagtcttccttctgctcacttagaa
aactcaagcaggttattttaagatgatcatagaaatatggtgactgctcactccttcaca
gaagaagatccagccatgtcaccacctgctaccccagagctccatcaagatgaagcacgg
gtgctagaggagctgtctgccaaggggaagcccagtctgagtttgcagaggatccaaagc
ccagggtcagggctccagaacataggcaacagctgctacctgaatgcagtcctgcagtgc
ttgacacacacaccacctcttgccgactatatgctgtcccaggagcattctcagaggtgt
tgttacccagaaggctgtaagatgtgtgctatggaagctcatgtgacccagagtctcctc
cactcccactcaggaggtgtcatgaaaccctccgagatattgacctctaccttccacaag
cacaggcaggaagatgcccatgaatttctcatgttcaccttgaatgccatgcatgaatcc
tgccttcgagggtgcaagcaatcagaaacctcctctaaggacagctccctgatctatgac
atatttggaggccagatgagatctcagatcaagtgtcaccactgccagggcaccttagat
tcctacgatcccttcctgaacctcttcctggatatctgctctgctcagagtgtgaagcaa
gccttggaggacttagtgaagctagaagagttgcagggggacaacgcctactactgtggt
aggtgtagagagaagatgccagcttctaagaccacgaaggttcagactgcctcaaaggtt
ctcctgctagtgttaaaccgctcctacgatttcgggggtgacaagttgaacagggtagta
agctacccagagtaccttgacctgcagccatacctgtcacagccaactgcaggacccctg
ccttatgctctctatgccgtcctggtccatgatggggtgacttgttccagtggacattac
ttctgttatgtcaaagccagccatgggaagtggtataagatggatgattctaaggtcacc
aggtgcgatgtgtcctctgtcctgagcgagcctgcctatctgctcttctatgtccagcag
actgaccttgagaaggtcaatgttgatgtgtctgtgggcagagtacatggggttcttcac
cctgaatcccagcagaagaaaacgcggaagaaaaagcacaagagaagctcttgcacagaa
gctgtacacatgccccgagaaaacagggaaaatacagccaccaaagaaacctccttaggg
gaggggaaagtgcttcaggaacagaaccaccagaaagctgggcagaacctcaagactacc
aaagtcaatttgtcagccaacggaactgtgattcatcagcccagatataccgcaaactgg
ggcaggaatgctccagacaaggacgatcaaccagggcacagtggtgacagactcctcacc
actcagggctccatgaacactgggcaactctgtggtcatggagggagccaaagatctaag
aagaggaagaacaagaacaagcaagggcagaggcctctgcttgtttgctag

DBGET integrated database retrieval system