KEGG   Rattus norvegicus (rat): 29367Help
Entry
29367             CDS       T01003                                 

Gene name
Chkb, Chetk, Chkl
Definition
(RefSeq) choline kinase beta
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00564  Glycerophospholipid metabolism
rno01100  Metabolic pathways
rno05231  Choline metabolism in cancer
Module
rno_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
rno_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    29367 (Chkb)
 Human Diseases
  Cancers
   05231 Choline metabolism in cancer
    29367 (Chkb)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     29367 (Chkb)
    2.7.1.82  ethanolamine kinase
     29367 (Chkb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH EcKinase Mei5
Motif
Other DBs
NCBI-GeneID: 29367
NCBI-ProteinID: NP_058873
RGD: 61826
Ensembl: ENSRNOG00000011404
UniProt: O54783
Position
7q34
AA seq 394 aa AA seqDB search
MAADGTGVVGGGAVGGPLSKDGLLDAKCPEPIPNRRRSSSLSRDAQRRAYQWCREYLGGA
WRRARPEELSVCPVSGGLSNLLFRCSLPNHVPSMGGEPREVLLRLYGAILQGVDSLVLES
VMFAILAERSLGPQLYGVFPEGRLEQYLPSRPLKTQELRDPVLSGAIATKMARFHGMEMP
FTKEPRWLFGTMERYLKQIQDLPSTSLPQMNLVEMYSLKDEMNHLRTLLDATPSPVVFCH
NDIQEGNILLLSEPDSDDNLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTYEEWPFYKARP
ADYPTREQQLLFIRHYLAEVQKGEVLSEEEQKKQEEDLLIEISRYALASHFFWGLWSTLQ
ASMSTIEFGYLEYAQSRFQFYFQQKGQLTSFLSP
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggatgggacaggtgtagtcggaggaggggctgtcggcggccccctgtccaag
gacggtttgctggatgctaagtgcccagaaccaatccccaatcggcggcgctcttcctcg
ctgtcccgtgacgcgcagcgccgagcctatcagtggtgccgggagtacctgggcggagcc
tggcgcagagcgcggccggaggagctgagcgtttgccccgtgagcggaggcctcagcaac
ctgctcttccgatgctcgctaccgaaccacgtgcccagtatgggcggggagccccgggag
gtgctgctacggctgtacggggctatcttgcagggtgtagactccttggtattagaaagc
gtgatgttcgccattcttgcagagagatctctagggccccaactttatggagtgtttcca
gagggccgcttggaacagtacctcccaagccggccattgaaaactcaagagctccgggac
ccagtgttgtcaggagccattgcaacaaagatggcccgtttccatggtatggagatgccc
ttcaccaaggagccccgctggttgtttgggaccatggagcggtacctaaagcagatccag
gacctgccgtccactagccttccccagatgaacctggtggagatgtacagcctcaaggat
gagatgaatcacctcaggacgttgctagacgctacaccgtccccagtggtcttctgccac
aatgacatccaggaaggaaacatcttactgctctcagagccagacagtgatgacaacctc
atgttggttgatttcgagtacagtagttacaactacaggggctttgacattgggaatcat
ttctgtgagtgggtttacgattacacttacgaggagtggcctttctacaaagcaagacct
gcagactaccccactagagaacagcagctccttttcatccgtcattatctggcggaggtt
cagaaaggtgaggtcctctccgaagaggagcagaagaaacaggaagaagatttgctgata
gagatcagccggtatgccctggcctctcatttcttctggggcctatggtccaccctccag
gcttccatgtccactatagagtttggctacttggaatacgcccaatctcggttccagttc
tacttccagcagaaggggcagctgaccagcttcctatcaccttga

DBGET integrated database retrieval system