KEGG   Rattus norvegicus (rat): 29367Help
Entry
29367             CDS       T01003                                 

Gene name
Chkb, Chetk, Chkl
Definition
choline kinase beta (EC:2.7.1.32 2.7.1.82)
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:rno00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q34
AA seq 394 aa AA seqDB search
MAADGTGVVGGGAVGGPLSKDGLLDAKCPEPIPNRRRSSSLSRDAQRRAYQWCREYLGGA
WRRARPEELSVCPVSGGLSNLLFRCSLPNHVPSMGGEPREVLLRLYGAILQGVDSLVLES
VMFAILAERSLGPQLYGVFPEGRLEQYLPSRPLKTQELRDPVLSGAIATKMARFHGMEMP
FTKEPRWLFGTMERYLKQIQDLPSTSLPQMNLVEMYSLKDEMNHLRTLLDATPSPVVFCH
NDIQEGNILLLSEPDSDDNLMLVDFEYSSYNYRGFDIGNHFCEWVYDYTYEEWPFYKARP
ADYPTREQQLLFIRHYLAEVQKGEVLSEEEQKKQEEDLLIEISRYALASHFFWGLWSTLQ
ASMSTIEFGYLEYAQSRFQFYFQQKGQLTSFLSP
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggatgggacaggtgtagtcggaggaggggctgtcggcggccccctgtccaag
gacggtttgctggatgctaagtgcccagaaccaatccccaatcggcggcgctcttcctcg
ctgtcccgtgacgcgcagcgccgagcctatcagtggtgccgggagtacctgggcggagcc
tggcgcagagcgcggccggaggagctgagcgtttgccccgtgagcggaggcctcagcaac
ctgctcttccgatgctcgctaccgaaccacgtgcccagtatgggcggggagccccgggag
gtgctgctacggctgtacggggctatcttgcagggtgtagactccttggtattagaaagc
gtgatgttcgccattcttgcagagagatctctagggccccaactttatggagtgtttcca
gagggccgcttggaacagtacctcccaagccggccattgaaaactcaagagctccgggac
ccagtgttgtcaggagccattgcaacaaagatggcccgtttccatggtatggagatgccc
ttcaccaaggagccccgctggttgtttgggaccatggagcggtacctaaagcagatccag
gacctgccgtccactagccttccccagatgaacctggtggagatgtacagcctcaaggat
gagatgaatcacctcaggacgttgctagacgctacaccgtccccagtggtcttctgccac
aatgacatccaggaaggaaacatcttactgctctcagagccagacagtgatgacaacctc
atgttggttgatttcgagtacagtagttacaactacaggggctttgacattgggaatcat
ttctgtgagtgggtttacgattacacttacgaggagtggcctttctacaaagcaagacct
gcagactaccccactagagaacagcagctccttttcatccgtcattatctggcggaggtt
cagaaaggtgaggtcctctccgaagaggagcagaagaaacaggaagaagatttgctgata
gagatcagccggtatgccctggcctctcatttcttctggggcctatggtccaccctccag
gcttccatgtccactatagagtttggctacttggaatacgcccaatctcggttccagttc
tacttccagcagaaggggcagctgaccagcttcctatcaccttga

DBGET integrated database retrieval system