KEGG   Rattus norvegicus (rat): 293860Help
Entry
293860            CDS       T01003                                 

Gene name
Flna, RGD1560614
Definition
(RefSeq) filamin A
  KO
K04437  
filamin
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    293860 (Flna)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    293860 (Flna)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    293860 (Flna)
  Infectious diseases
   05132 Salmonella infection
    293860 (Flna)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     293860 (Flna)
  Intermediate filaments
   Intermediate filament-binding proteins
    293860 (Flna)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   293860 (Flna)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
X
AA seq 2639 aa AA seqDB search
MSSSHSRSGQSAAGASPAGGIDTRDAEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCV
SKRIANLQTDLSDGLRLIALLEVLSQKKMHRKHNQRPTFRQMQLENVSVALEFLDRESIK
LVSIDSKAIVDGNLKLILGLIWTLILHYSISMPMWDEEEDEEAKKQTPKQRLLGWIQNKL
PQLPITNFSRDWQSGRALGALVDSCAPGLCPDWDSWDASKPVNNAREAMQQADDWLGIPQ
VITPEEIVDPNVDEHSVMTYLSQFPKAKLKPGAPLRPKLNPKKARAYGPGIEPTGNMVKK
RAEFTVETRSAGQGEVLVYVEDPAGHQEEAKVTANNDKNRTFSVWYVPEVTGTHKVTVLF
AGQHIAKSPFEVYVDKSQGDASKVTAQGPGLEPSGNIANKTTYFEIFTAGAGIGEVEVVI
QDPTGQKGTVEPQLEARGDSTYRCSYQPTMEGVHTVHVTFAGVPIPRSPYTVTVGQACNP
TACRAVGRGLQPKGVRVKETADFKVYTKGAGSGELKVTVKGPKGEERVKQKDLGDGVYGF
EYYPTIPGTYTVTITWGGQNIGRSPFEVKVGTECGNQKVRAWGPGLEGGIVGKSADFVVE
AIGDDVGTLGFSVEGPSQAKIECDDKGDGSCDVRYWPQEAGEYAVHVLCNSEDIRLSPFM
ADIREAPQDFHPDRVKARGPGLEKTGVAINKPAEFTVDAKHAGKAPLRVQVQDNEGHSVE
TTVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGVA
KTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYTP
CGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNAK
TAGKGKLDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYTPVQQGPVGVSVTYGGDHIPKSP
FSVGVSPSLDLSKIKVSGLVDKVDVGKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCKV
EPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPVEAVAPTKPSKVKAFGPGLQGG
NAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINILF
ADTHIPGSPFKAHVVPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICSE
AGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQC
YGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKVE
YTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVET
RGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFKV
PVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDVV
DNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTGV
PASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVTGRYTILI
KYGGDEIPFSPYRVRAVPTGDASKCTVTGAGIGPTIQIGEETVITVDTKAAGKGKVTCTV
CTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVTALAGDQPTV
QTPLRPQQLPSQYTYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTIKKGEITGEV
RMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHI
TAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVL
PGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETDLSLLTATVV
PPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVISQSEIGDAS
RVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCP
TEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPE
ISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQHVPGSPFQF
TVGPLGEGGAHKVRAGGPGLERAEAGVPAEFGIWTREAGAGGLAIAVEGPSKAEISFEDR
KDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSSLQESGLKVN
QPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNG
THIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGAGALSVTIDG
PSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLH
ETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFTVDCSKAGNN
MLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPGSPYRIMVP
NT seq 7920 nt NT seq  +upstreamnt  +downstreamnt
atgagtagctctcactcccgctccggccagagtgcggcaggcgcgtctccggcaggcggt
attgatacacgggacgctgagatgccggctaccgaaaaagacctagcagaagatgcacca
tggaagaagatccagcagaacacatttacccgctggtgcaatgagcaccttaagtgcgtg
agcaagcgcatcgccaatctgcagacggacctgagcgatggattgcggctcatcgcgctg
cttgaggtactcagccagaagaagatgcaccgcaagcacaaccaacgacccactttccgc
cagatgcagctggaaaatgtgtctgtggcgcttgaattcctggaccgtgagagcatcaag
ctcgtgtccatagacagcaaggccattgtggatgggaatctgaaactgatcttaggactc
atctggaccctgatcctgcactactccatctcgatgcccatgtgggatgaggaagaggat
gaggaggccaagaagcaaacacccaaacagaggcttctaggctggattcagaacaagctg
ccacagctgcccattaccaacttcagtcgagactggcagagtggccgggccctgggtgct
cttgttgatagctgtgccccaggcctatgtcctgactgggactcctgggatgctagtaag
cctgtgaacaatgcacgggaagccatgcagcaggctgacgactggctgggcattcctcag
gtgattaccccagaagaaattgtggaccccaacgtagatgagcattctgttatgacttac
ctgtctcagtttcccaaggccaaactgaagccaggggctcctcttcggcccaaactgaac
ccaaagaaagcccgagcctatgggccaggcatcgagcccacaggcaatatggtgaagaag
agagcagaattcactgtggagacccgaagtgcaggacagggagaggtgctggtatatgtg
gaggacccagctggacaccaggaagaggcaaaagtgactgccaataacgacaagaaccgt
actttctctgtctggtatgtccctgaagtaacaggaactcataaggtgactgtgctcttt
gctggccaacatattgccaagagcccctttgaggtgtatgtggacaagtcacagggtgat
gccagcaaagtgactgcccagggccctggtctggagcccagcggcaatatcgccaacaag
actacctactttgagatcttcactgcaggagctggcataggcgaggtggaagttgtcatc
caggaccctacaggacagaaaggcacagtggaacctcagctggaggccaggggtgacagc
acctatcgctgtagctatcagcctaccatggagggtgtccatacagtacatgtcaccttc
gctggtgttcccatccctcgcagcccctacactgtcactgttggtcaagcttgtaaccca
actgcctgccgggctgttggtagaggcctccagcctaagggtgtgcgagtgaaggaaaca
gctgacttcaaggtgtacacaaaaggcgctggcagtggggagctaaaggtcactgtaaag
ggtcccaagggtgaagagcgtgtaaagcagaaggacttaggggatggtgtgtatggcttt
gaatattaccccacaatccctggcacatacactgtcaccatcacatggggtggccagaac
attggccgcagtccgttcgaggtgaaggtaggcactgagtgtggcaatcagaaggttcgg
gcatggggtcctggtctggaaggtggcattgttggcaagtcagcagacttcgtagtagag
gccattggtgatgatgtgggcaccttgggtttctctgtggaaggtccatcacaggcaaag
attgaatgtgacgacaagggtgatggctcttgtgatgtgcgctattggccccaggaggct
ggcgagtatgctgttcatgtgctatgtaacagtgaggatatccggctcagtcccttcatg
gctgacatccgtgaggcacctcaggattttcacccagaccgggtgaaggcacgtgggcct
ggattggagaagactggtgtagctatcaacaagccagcagagttcacagttgatgccaag
catgctgggaaggcccctcttcgagttcaagttcaggacaatgaaggacactctgtggag
acaacagtcaaggacaatggcaatggtacttacagctgttcttatgtgcccagaaagcca
gtgaagcacacagccatggtttcttggggaggtgtcagcatccccaatagtcctttccgg
gtgaatgtgggagctggcagccacccaaacaaagtcaaggtgtatggtccaggagtggcc
aagactgggctcaaggcccatgaacctacctactttactgtggattgtactgaggcgggc
cagggagatgtcagcattggtatcaagtgtgcccctggagtagtgggccccactgaggct
gatattgactttgatatcatccgtaatgacaatgacaccttcactgtgaaatacacaccc
tgtggggctggcagctataccatcatggttctttttgctgaccaggccacacccaccagc
cccatcagagtcaaagtggagccttctcatgatgccagtaaagtgaaggctgagggtcct
ggcctaaatcgcactggtgttgagcttggcaaacccacccatttcacagtcaatgctaaa
actgctgggaaaggcaagctggatgttcagttctcaggactggctaagggagatgcagtg
cgagatgtggacatcattgaccaccatgataatacctacaccgtaaagtatactcctgtg
cagcagggcccagtaggtgtcagtgtcacttatggaggagatcacatacccaagagtcca
ttttcagtgggagtatctccaagcctggatctcagcaagattaaggtgtctggccttgtt
gacaaagtggatgttggcaaagatcaagagttcacagtaaagtcaaagggtgcaggtggt
caaggcaaagtagcatccaagattgtgagtccctcaggtgcagcagtgccctgcaaggta
gagccaggcctgggagctgacaacagtgtggtccgttttgtgccccgtgaagaggggcct
tatgaggtggaagtgacctatgatggtgtgcctgtacctggcagtccctttccagtagaa
gctgtggctcctaccaaacccagcaaggtgaaggcatttggaccagggctgcaggggggc
aatgcaggctcccctgcccgcttcaccattgatacaaagggagctggcactggtggcctg
ggcctgacagtggaaggcccctgtgaagcacagcttgagtgcctggacaatggggacggt
acatgctctgtgtcttatgtgcccactgagcctggggactacaacatcaacatccttttt
gctgacacccacattcctggatccccattcaaggcccatgtggttccttgttttgatgca
tccaaggtgaagtgctcaggccctgggctggagcgggctactgctggtgaggtagggcag
ttccaagtagactgctcaagtgctggcagtgccgagttgacgattgagatctgctctgag
gcaggactgccagctgaagtatacattcaggaccatggtgatggcacacacaccattacc
tatattcctctttgtcctggggcttacactgttaccatcaagtatggtggccagcctgtg
cccaacttccccagcaagctacaggtggagcctgctgtagatacctcaggcgtacagtgc
tatgggcctgggattgaaggtcaaggtgtcttccgagaggcaaccactgagttcagtgta
gatgcccgggctcttacacagactggagggccacatgtcaaggcccgtgtggccaacccc
tcaggcaatctgacagatacctatgtgcaagactgtggtgatggcacatacaaagtggaa
tatactccatatgaggaaggagtacactccgtggatgtgacttatgatggcagccctgta
cccagcagccccttccaggtgcctgtaacagagggctgtgacccctcccgggtgcgtgtc
catgggccaggcatccaaagtggtaccaccaacaaacccaacaagttcacagtagagact
aggggagctggcacaggtggcctgggcttggctgttgagggtccctcagaggccaagatg
tcttgtatggataataaagatggcagctgctcggtagaatacatcccctatgaagctgga
acctatagccttaacgtcacttatggtggtcaccaagtgccaggtagccccttcaaggtt
cctgtacatgatgtgacagatgcatctaaagtcaagtgttctggacctggcttaagccca
ggcatggtccgtgccaacctccctcagtcctttcaggtagacacaagcaaagccggagtt
gccccactgcaggtcaaagtacaggggcccaaaggcctggtggagccagtggatgtagtg
gacaatgctgatggtactcagactgtcaactatgtgcccagccgagaagggtcctatagc
atttctgtgctgtatggtgaagaagaagtgccacggagccccttcaaggtcaaggtgctg
cccacgcatgatgccagtaaggtgaaggccagtggacctggactcaacaccactggtgtg
cctgccagcctgcctgtggagttcaccattgatgccaaggatgctggggagggtctgttg
gctgtccagattacggaccctgaaggcaagcccaagaagacacacatccaagataatcat
gatggcacatacacagtggcctatgtgccagatgtgacaggccggtacacaatcctcatc
aagtatggtggtgatgagatccccttttccccataccgtgtccgggctgtgcccactggg
gatgccagcaagtgcacagtcacaggtgctggcattggccccaccatccagattggagag
gagacagtgattactgtggacacaaaagcagcaggcaaaggcaaagtgacttgcacagtg
tgcacacctgatggctcagaggtagatgtggacgtggtggagaatgaggatggcaccttt
gacatcttctacacagccccgcaaccgggcaaatatgtcatctgtgtgcgcttcggtggc
gagcatgtgcccaacagccccttccaagttacagctttagctggggaccaaccaacagtg
cagaccccattaaggcctcagcagctgccttcacagtatacctatcctcagggtagccag
caaacatggattccagagaggcccatggtgggcgttaatgggctggatgtgaccagcctg
aggccctttgatcttgtcatccccttcactatcaagaagggtgagatcactggggaagtt
cgaatgccctctggcaaggtggcccagccttccatcactgacaacaaagatggcactgtt
actgtgcgttactcacccagtgaagctggcctgcatgaaatggacattcgctatgacaat
atgcatatcccaggaagccctctgcagttctatgttgattatgtcaactgtggtcacatc
actgcctatggtcctggccttacccatggagtggtcaacaaacctgccaccttcactgtc
aacaccaaggatgcaggagaagggggcttgtctctggccattgagggtccatctaaagca
gaaatcagctgcactgacaaccaggatgggacatgcagtgtctcttacctgcctgtgctg
cctggtgactacagcatcctagtcaagtacaatgaccagcacatcccaggcagccccttc
actgccagagtaacaggtgatgattccatgcgtatgtcccacctaaaggtgggttctgct
gctgatatccccatcaacatctcagaaacagacctcagcctactcacagccactgtggtg
ccaccttcaggtcgagaggaaccctgtctgctgaaacggttgcgtaatggccacgtgggg
atttccttcgtgcccaaggagacaggggagcacctggtacacgtgaagaagaatggccag
catgtggcaagcagtcccatcccagtagtgatcagccagtcggagataggtgatgccagc
cgtgtaagggtctctggtcaaggcctccatgaaggccatacctttgagcctgcagagttt
attattgacaccagagatgcaggctatggtgggctcagtctgtccattgagggccctagc
aaagtagacatcaacacagaggacctggaggacggcacatgcagggtcacctactgtccc
acagagcctggaaactacattataaacatcaaatttgctgaccaacatgtgcctggcagt
cctttttctgtgaaggtgacaggtgagggccgggtaaaagagagtatcacacgcaggcga
cgtgccccttctgtggccaatgttggcagtcattgtgacctcagcttgaagattcctgaa
attagcatccaagatatgacagcccaggtgaccagcccatcaggcaagacccatgaggca
gagattgtagaaggagagaaccatacttactgtatccgatttgtgcctgctgagatgggg
atgcatacagtcagtgtcaagtacaagggccagcatgtacctgggagccccttccagttc
actgtgggacctctgggggaagggggtgctcacaaggtccgtgctggaggccctggccta
gagagggctgaagctggagtaccagcggagttcggcatttggactagggaagctggcgct
ggaggcctggccattgctgttgaaggccctagcaaggctgagatctcttttgaggaccga
aaggatggctcttgtggtgtggcctacgtagttcaggagccaggtgactatgaggtctca
gtcaagttcaacgaggaacacatacctgatagccccttcgtggtgcctgtggcttctccg
tctggtgacgcccgccgccttactgtttctagtcttcaggagtcagggttaaaggtcaac
cagccagcatcttttgcagtcagcctgaatggagccaaaggggcaattgatgccaaggtg
catagcccctcaggagctctggaggagtgctatgtcacagagattgaccaagataagtat
gctgtgcgtttcatcccacgagagaatggcgtctacttgatcgatgtcaagttcaatggt
actcacatccctggaagtcccttcaagattcgagttggggagcctggtcatggaggggac
ccaggcttagtatccgcctatggagcaggcctggaaggtggtgtcacagggagcccagct
gagtttattgtgaacacaagcaatgcaggagctggtgccctttcggttaccattgatggc
ccctccaaggtgaagatggattgccaggagtgccctgagggctaccgtgtcacctatacc
cccatggcacctggcagctacctcatctccatcaagtatggtggcccctatcacattggg
ggaagccccttcaaagccaaggtcacaggtccccgtcttgttagcaaccacagcctccat
gagacatcatctgtgtttgtggactctctgactaaagttgctactgttccccagcatgca
acctcaggcccaggtcctgctgatgtcagcaaggtagtagccaaaggcctggggctaagc
aaagcttatgtaggccagaagagcaacttcacagtagattgcagcaaagcaggtaacaac
atgttgctggtgggcgtgcatggcccaaggacaccctgtgaagagatcctggtgaaacac
atgggcagtcgcctctatagtgtctcctacctgctcaaagacaaaggggaatacacattg
gtggtcaagtggggtgatgagcatatcccaggcagcccataccgcattatggtgccctga

DBGET integrated database retrieval system