KEGG   Rattus norvegicus (rat): 293874Help
Entry
293874            CDS       T01003                                 

Gene name
Trpm6
Definition
(RefSeq) transient receptor potential cation channel, subfamily M, member 6
  KO
K04981  
transient receptor potential cation channel subfamily M member 6 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Mineral absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    293874 (Trpm6)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     293874 (Trpm6)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   293874 (Trpm6)
Ion channels [BR:rno04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPM (Melastatin/Long TRP)
   293874 (Trpm6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
1q43
AA seq 2024 aa AA seqDB search
MQVKKSWIERVFYKRECNKFIPSSKDPHRCTPGCQICQNLVRCYCGRLIQEHQGLDRAWS
LSATEGNGNEQWSVEKHTVKSPTDTFGTINFQDGEHIYHSKYIRTSWDTKSDHLLHLMLK
EWNMELPKLVISVHGGLQNFKMPSKLKETFSQGLVKAAETTGAWIITEGINSGVSKHVGD
ALKAHSSMSLRKIWTVGIPPWGVIENQRELVGKDVVCMYQTLSNPLSKLTTLNCMHSHFI
LCDDGTVGKYGNEEKLRRNLEKHLSMQKIHTCSRQGVPVVGLVVEGGPNVILWVWETVRN
KEPVVVCEGTGRAADLLAFTYKHSEDGGILRPQVKEEILCLIQNMFNFSLRQSKHLFQIL
MECMVHKDSITIFDADSEEHQDLDLAILKALLKGTSLSISEQLNLAMAWDRMDIAKKHIL
IYGQHWKPGALEQAMRDALVMDRVDFVKLLIENGVNLHRFLTISRLEDLYNTKQGPTNKF
LRHLVQDVKQHTLLSSYRITLIDIGLVIEYLIGGAYRSSYTRKSFRVLYNDLYRKHKGMT
SFAQGLSQHPLHQRHSLGNRKESSESTLHSQFFRTAQPYKSKDKPEDSHKPKKKSKERHS
LSEDPGSAGFIYPYNDLLVWAVLMKRQKMAMFFWQHGEEATVKAVIASILYRAMAREAKE
SNMVDDTSEELKKYSEQFGQLALDVLEKAFKQNEPMAMKLLTYELKNWSNSTCLKLAVSG
GLRPFVSHSCTQMLLTDMWMGRLKMRKNSWLKIIISILLPPMILTLEFKSKAEMSHVPQS
QDFQFTWNYSDQGLSNTKEAKDYDLERGPDEKLDEALHLDLRNVPQSLPWTRRVYEFYSA
PFVKFWFYTMAYLAFLMLFTYTVLVEMQPQPSVQEWLVIIYIFTNAIEKVREICISEPSK
FTQKVKMWLSEYWNLMETVAIGLFAVGFGLRWGHPPLHTAGRLIYCIDIIFWFSRLLDFF
AVNQHAGPYVTMIAKMAANMFYIVIIMAIVLLSFGVARKAILSPKEPPSWRLARDIVFEP
YWMMYGEVYASEIDVCSNETSCPPGSFLTPFLQAVYLFVQYIIMVNLLIACFNNIYLDIK
SISNKLWKYNRYRYIMTYHQKPWLPPPFILISHLCLLLRGLCCRPAPQDQEEGDMGLKLY
LTKDDLKKLHDFEEQCVEKYFHEKTEGLNCSCEEQIRATSERVSEMFFQLKEMNEKVSFI
KDSLLSLDSQVGHLQDLSALTVDTLKVLSAVDTLQEDEILLANRKHSTCRKRPHSWTNVI
CAKVLTDMESCGKQKFQYYSMPPSLLRSLARSQLPPGVQRGALVEVTHNTREASHVREDQ
KEREVEQRTIASGVSHVRQAHSKYGQFLLVPPSEKQVSLSLENPPHLFRASGETGTDDVA
LQHRHPSDVTIHLPGQTPAVSHQALGAEHKDQHEAVIQMSGKPDKAEQDSLKFSGTPAPM
AVTSLPSRAISMQDEGGYVNWAFSESDEAGVFSFKKKWKTCLASTCDSGSKPGGDCSLQA
AGRSGLDNSRLAQSCEWPAGPWTQARRSFWINPLCRDKPLLKSHSFRFHKEEKLRKTWKN
NSHSKASETGSTWLKAKLLTKNRSLSKKRRKAQGLQVPVITVNACYQSDQLTSESGETNT
TEDYSKNWLSVSNFSQIGLEPYIYQKMKMKEIERHTTQASYHLRQMQEDPDKNPSWNSRS
ASVSRSFLTRSPNEVDKISASLKSPPEPHRHYSAIERNNLMRLSQTIPFTPIQLFTGEEV
TIYKLEETSPLTLDKSMSSWSQHGRAAIIQVLSQEEMDGGLRKAMRVISTWSEDDVLKPG
QVFIVKSFLPEVVQTWYKIFQESTVLHLCLREIQQQRAAQKLIYTFNQVKPQTIPYTPRF
LEVSLVYCHSANQWLTIEKYMTGEFRKYNNNNGDEIAPTNTLEELMLAFSHWTYEYTRGE
LLVLDLQGVGENLTDPSVIKPEDKQSRGMVFGPANLGEDAIRSFIAKHRCNSCCGKLRLP
DLKRNDYSHARAHCNLELAKTTEPAEEHPERDRNRSPLEDHTRL
NT seq 6075 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcaagaaatcctggattgaaagagtattctacaagagagaatgtaacaaattc
atacccagctccaaggaccctcacagatgcactccaggctgccaaatctgccagaattta
gtcaggtgttactgtgggcggctgattcaagagcaccaggggctagatcgtgcctggagc
ctctcagccactgagggcaatggaaacgagcagtggtctgtcgagaagcacacggtgaaa
agccctacagataccttcggcaccattaacttccaagatggcgaacatatctaccactcc
aagtacattagaacttcttgggataccaaatcagatcatctgttgcacttaatgttgaaa
gagtggaatatggagctgccgaagcttgtgatctctgttcatgggggtcttcagaacttc
aagatgccctccaagctcaaagagaccttcagccaggggctggtcaaagctgcagagacc
acaggagcatggataattactgaaggcataaactcaggagtgtccaagcatgttggggat
gccctaaaagcccattcctctatgtctttgaggaaaatctggacagttggaatccctcct
tggggtgtcattgagaaccagagagagctggttggaaaagatgtggtgtgtatgtaccag
accctgagtaacccactgagcaagctcaccacactcaactgtatgcactctcacttcatc
ctgtgtgatgatgggactgtgggcaagtatggaaatgaagagaagctcaggcggaacctg
gagaagcatctctcgatgcagaagatacacacctgctcaaggcaaggtgtgcctgtggtg
ggactggtggtggaaggaggccccaatgtcatcctctgggtatgggagactgtcaggaac
aaggagcctgtggtggtgtgcgaggggaccggcagagctgctgacctcctggccttcacc
tacaaacattcggaggatggagggattctacgccctcaggtgaaagaagagatcttgtgt
ttgattcagaacatgttcaactttagcctgagacagtctaagcaccttttccaaattcta
atggagtgcatggttcacaaggattctattaccatatttgatgctgattctgaggagcac
caggaccttgatttggcaatcctcaaggctttgctgaagggtacaagcttatccatatca
gaacagttaaatctggcaatggcttgggatagaatggacattgccaaaaaacatatccta
atttacggacaacattggaagcctggtgctctggaacaagcaatgcgagatgccttagtg
atggatcgagtggacttcgtgaagctcttgatagagaatggggtgaacctacaccgcttc
ctcaccatctcccggctggaagatctctataacacaaaacaaggaccaacgaataagttt
ttgcgtcatcttgtccaagatgtaaagcagcatacccttctctcgagctacagaataaca
ctcatcgacattgggctggtaatagagtacctcattggtggagcgtatcgaagcagctac
actaggaaaagtttcagagttctctacaacgacctctacagaaaacacaagggtatgact
agctttgctcagggtctttcccagcaccctcttcatcagagacattcattaggaaataga
aaggagtcttcggaaagcacactgcactcccagttcttcaggacggcccagccctacaaa
tccaaggacaagcctgaagactctcataaaccaaagaagaagtccaaggaaagacacagc
ctgtcagaggaccccgggtctgctggctttatctacccatacaatgacctgctggtgtgg
gcggtgctcatgaagagacagaagatggccatgttcttctggcagcatggagaggaggcc
acagtcaaggcggtcattgctagcatcctctacagagccatggcccgggaagctaaggag
agcaacatggtagatgatacttcagaagagttgaagaagtactcagagcagtttggccag
ctcgccctggatgtattagagaaagccttcaagcagaacgagccgatggccatgaagctg
ttgacctatgaactcaagaactggagcaattctacctgcttgaaactggcagtgtctgga
ggcctgcgcccttttgtgtcacattcttgtacccaaatgctgctgacagacatgtggatg
gggcgtttgaaaatgaggaaaaactcctggctgaagataatcatcagcatcctcttacca
cccatgattttgacgttggaatttaaaagcaaagcggagatgtcacatgtcccacagtcc
caggatttccagtttacatggaattacagtgaccagggtctgagtaacaccaaagaagcg
aaagactacgatttggaaagaggccctgatgagaaactggatgaagctctgcatttagac
ttaagaaatgtgccccagagccttccctggaccagaagagtctacgagttctacagtgct
ccgtttgtcaagttctggttctacacgatggcttatttggcattcctcatgctgttcact
tacacagtgttggtggagatgcagccccaacccagcgtgcaagagtggcttgtcatcatc
tacatcttcaccaatgctattgagaaggtcagggagatctgcatttcagaaccaagcaag
tttactcagaaggtgaagatgtggctcagtgagtactggaacctgatggaaactgtggct
attggcctgtttgccgttggctttggcctacggtggggacatccacctttgcatactgca
gggagactcatctactgcatagacatcatattttggttttctcggctcctggatttcttt
gctgtgaatcaacatgcaggtccatatgtgaccatgattgcaaaaatggcagcaaacatg
ttctacattgtgatcatcatggccattgttctgctgagctttggcgtggcacgcaaagcc
atcctgtcaccaaaggagcctccttcatggcgcctggctcgtgatattgtattcgagcca
tattggatgatgtatggagaagtctatgcttcagagatagatgtttgttcaaatgagaca
tcttgccctccgggttctttcctgactccattcctgcaagccgtctacctctttgtgcaa
tatatcatcatggtgaacttgctgattgcctgtttcaacaacatttacttagacataaaa
tccatctcaaacaagctctggaaatacaaccgctatcgctacatcatgacctaccaccag
aagccctggctgcccccacccttcatcctgataagtcacctgtgcctgctcctccgagga
ctgtgctgtcgcccagcgccacaggaccaggaagagggtgacatggggctaaaactctac
ctcactaaggatgacttgaaaaagcttcatgattttgaagagcagtgtgtggaaaaatat
ttccatgagaagacggaaggtctgaattgtagttgtgaggaacagatccgagcgacatcc
gaaagggtatcagagatgttcttccaactgaaagaaatgaatgaaaaagtgtcttttata
aaggactctctactatccctggacagccaggtgggacacctacaggatctctctgccttg
accgttgacaccttgaaggtcctttctgctgttgacaccttgcaagaagacgagattctg
ctggccaacagaaaacattctacttgcagaaaacgtccccacagctggaccaatgtcatc
tgtgcaaaggttctgactgacatggagagctgtgggaagcagaaatttcagtactatagc
atgcccccttctttgctgaggagccttgctagaagccagcttcccccaggagtgcaaagg
ggtgcccttgtagaggttacacacaatacgagagaggcctcacatgtaagagaagaccag
aaggaacgagaagtggaacagagaacaatcgcttctggggtttcccatgtcagacaagca
cactctaagtatggtcagtttctcctggtcccaccttctgaaaagcaagtttctttgtct
ctggaaaaccccccacatcttttcagagcctctggggagacaggtacagatgatgtggca
ttgcaacatagacacccaagtgacgtcaccatccacttgcctgggcaaactcctgctgtc
tcccaccaggcattgggagcagaacacaaagatcaacatgaggcagttatacagatgtca
ggcaaacctgacaaggcagaacaagactcactcaaattcagtggcacacctgctcccatg
gcagtgacttctcttccttcaagagccatcagcatgcaagatgaaggtggatatgtgaac
tgggcattttcagaaagtgatgaagcaggtgtgtttagttttaaaaagaagtggaaaact
tgcttggcttccacttgcgacagtggctccaaaccaggtggagactgctccctccaggct
gcaggcaggtccgggctggataactcaagactggcccagagttgtgagtggccagcagga
ccgtggacccaggcaagaagatccttttggatcaatcctctctgcagagataaacctctc
cttaagagtcatagttttagattccacaaggaggagaaactgaggaagacctggaagaac
aacagccattcaaaagcctcagagactgggtcaacatggctcaaagcaaagctgctaacc
aagaataggagtctgtcaaagaaaaggaggaaggcccagggactccaggtgccggtgata
acagtcaatgcctgctatcaaagtgaccaattgacttcagagtccggagaaacaaacacc
actgaagactacagcaagaactggctttccgtgtccaacttcagccagataggtttagaa
ccttatatataccagaaaatgaaaatgaaggaaatcgaacgacatactactcaagccagt
taccacctaaggcagatgcaagaggacccggataaaaacccctcatggaattccaggagc
gccagcgtcagcaggagttttctaacaagaagcccaaatgaagttgacaagatctcagcc
tctttaaaaagccctccagagcctcaccgccattattcagccattgaaaggaataattta
atgagactgtctcagaccataccgtttacaccaatccagctgttcacaggagaggaagtg
accatctacaagcttgaagagacttcccctctgacccttgataagagcatgtcctcttgg
tcccagcatggtagagctgccataatccaggtgctgtcacaagaggagatggatgggggc
ctccgcaaagccatgcgcgttatcagcacctggtctgaggatgacgttctcaagcccggg
caggttttcattgtgaagtcttttctccccgaggtcgtgcagacatggtataaaatcttc
caggagagcactgtgcttcacctttgccttagggaaattcaacagcaaagagctgcccaa
aaactcatctataccttcaaccaagtaaaaccacaaaccattccctatacaccaagattt
cttgaggtttccttggtctactgccattcagctaaccaatggttaaccattgagaagtac
atgacaggggagttccggaaatacaataacaacaatggcgatgaaattgcccccaccaac
accctggaagaactgatgttggctttctctcactggacctatgagtatacccggggagag
ctgctggttttagatttgcaaggtgttggagaaaatttgacagatccatctgttataaaa
ccggaagataaacaatcaagagggatggtgtttggaccggccaatttaggggaagatgca
attagaagcttcattgcaaaacatcgctgcaactcctgctgtgggaagctcaggctgccg
gatttaaaaaggaatgactactcccatgcaagggcacattgcaacttggaacttgcaaaa
accactgaaccagctgaggaacatccagaaagagacagaaatagaagtcccctggaagat
cacacacgcctttaa

DBGET integrated database retrieval system