KEGG   Rattus norvegicus (rat): 293989Help
Entry
293989            CDS       T01003                                 

Gene name
Cyp2c6v1, CYPIIC6, Cyp2c6, PB1, PTF2
Definition
(RefSeq) cytochrome P450, family 2, subfamily C, polypeptide 6, variant 1
  KO
K07413  cytochrome P450 family 2 subfamily C [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00140  Steroid hormone biosynthesis
rno00590  Arachidonic acid metabolism
rno00591  Linoleic acid metabolism
rno00830  Retinol metabolism
rno01100  Metabolic pathways
rno04726  Serotonergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    293989 (Cyp2c6v1)
   00590 Arachidonic acid metabolism
    293989 (Cyp2c6v1)
   00591 Linoleic acid metabolism
    293989 (Cyp2c6v1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    293989 (Cyp2c6v1)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    293989 (Cyp2c6v1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    293989 (Cyp2c6v1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    293989 (Cyp2c6v1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     293989 (Cyp2c6v1)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   293989 (Cyp2c6v1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 293989
NCBI-ProteinID: NP_001013926
RGD: 619934
Ensembl: ENSRNOG00000024016
Vega: OTTRNOG00000002451
UniProt: Q5EB99
Position
1q31
AA seq 490 aa AA seqDB search
MDLVMLLVLTLTCLILLSIWRQSSGRGKLPPGPIPLPIIGNIFQLNVKNITQSLTSFSKV
YGPVFTLYFGMKPTVILHGYEAVKEALIDHGEEFAERGSFPVVEKINKDLGIVFSHGNRW
KEIRRFTLTTLRNLGMGKRNIEDHVQEEARCLVEELRKTNGSPCDPTFILGCAPCNVICS
IIFQNRFDYKDQDFLNLMEKLNENMKILSSPWTQFCSFFPVLIDYCPGSHTTLAKNMYYN
RNYLLKKIKEHQESLDVTNPRDFIDYYLIKWKQENHNPNSEFTLENLSITVTDLFAAGTE
TTSTTLRYALLLLLKCPEVTAKVQEEIDRVVGKHRSPCMQDRSRMPYTDAMIHEVQRFID
LIPTNLPHAVTCDIKFRNYLIPKGTTIITSLSSVLHDSKEFPDPEIFDPGHFLDGNGKFK
KSDYFMPFSAGKRMCAGEGLARMELFLFLTTILQNFKLKSVLHPKDIDTTPVFNGFASLP
PFYELCFIPL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggatctggtcatgttgctggtgctcactctcacctgtcttattctcctgtcaatctgg
agacagagttctgggagaggaaagctccccccaggccctattcctctcccaattattggc
aatatctttcagctaaatgtgaagaacatcacccaatccttaaccagtttctcaaaagtg
tatggtcctgtatttactctttactttggcatgaagcccactgtgatattgcatggatat
gaagcagtaaaagaagccttgattgatcatggggaggagtttgctgaaagaggaagcttc
ccagtagttgaaaaaattaataaagaccttggaattgtttttagccatggaaatagatgg
aaagaaataagacgctttaccctcacaactctgcggaatttgggcatggggaaaaggaac
attgaggatcatgttcaagaggaagcacggtgccttgtggaggaactgaggaaaaccaat
ggctcaccctgtgaccccacgtttatcctgggctgtgctccttgcaatgtcatctgctcc
attattttccagaatcgttttgattataaagatcaggattttcttaacttgatggaaaaa
ctcaatgagaacatgaagattttgagcagtccctggacacagttttgcagttttttccct
gttttaattgattattgtccgggaagtcatacgacattagctaaaaatatgtattataat
agaaactaccttctgaagaaaataaaagaacatcaagaatcactggatgttacaaatcct
cgggactttattgattattacctaattaagtggaagcaggaaaatcacaatccaaattca
gaatttacacttgaaaacttatcaatcactgtgactgatttgtttgctgctgggacagag
acaacaagcacaacactgagatatgctctgttgctcctgctgaagtgtccagaagtcaca
gctaaagtccaggaagagattgatcgtgtggttggcaaacatcgcagcccttgcatgcag
gacaggagccgcatgccctacacagatgccatgattcatgaggtccagaggttcattgac
ctcattcctaccaacctgccacatgcggtgacctgtgacattaagttcaggaactaccta
atacccaagggaacaacaataataacatcactctcatcagtgctgcatgacagcaaggaa
ttccccgacccagagatatttgaccctggccactttttagatgggaatggaaagtttaag
aaaagtgactatttcatgcctttctcagcaggaaaacggatgtgtgcaggagagggccta
gcccgcatggagttatttttattcctgaccacgattttacaaaactttaagctgaaatct
gtacttcacccaaaggatatcgatacaactccagttttcaatggatttgcctctctgcca
ccattttatgagctgtgcttcattcctctctaa

DBGET integrated database retrieval system