KEGG   Rattus norvegicus (rat): 29415Help
Entry
29415             CDS       T01003                                 

Gene name
S1pr2, Edg5, GPCR18, Gpcr13, H218, snGPCR18
Definition
(RefSeq) sphingosine-1-phosphate receptor 2
  KO
K04292  
sphingosine 1-phosphate receptor 2
Organism
rno  Rattus norvegicus (rat)
Pathway
Sphingolipid signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    29415 (S1pr2)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29415 (S1pr2)
G protein-coupled receptors [BR:rno04030]
 Class A. Rhodopsin family
  Lipid
   Sphingolipid [OT]
    29415 (S1pr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8q13
AA seq 352 aa AA seqDB search
MGGLYSEYLNPEKVQEHYNYTKETLDMQETPSRKVASAFIIILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGPVTLSLTPLQWFAREGSAFITLSASV
FSLLAIAIERQVAIAKVKLYGSDKSCRMLMLIGASWLISLILGGLPILGWNCLDHLEACS
TVLPLYAKHYVLCVVTIFSVILLAIVALYVRIYFVVRSSHADVAGPQTLALLKTVTIVLG
VFIICWLPAFSILLLDSTCPVRACPVLYKAHYFFAFATLNSLLNPVIYTWRSRDLRREVL
RPLLCWRQGKGATGRRGGNPGHRLLPLRSSSSLERGLHMPTSPTFLEGNTVV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtttatactcagagtacctcaatcctgagaaggttcaggaacactacaattac
accaaggagacgctggacatgcaggagacgccctcccgcaaggtggcctccgccttcatc
atcattttatgctgtgccatcgtggtggagaaccttctggtgctaatcgcagtggccagg
aacagcaagttccactcagccatgtacctgttcctcggcaacctggcagcctccgacctg
ctggcaggcgtggccttcgtggccaacaccttgctctccggacctgtcaccctgtcctta
actcccttgcagtggtttgcccgagagggttcagccttcatcacgctctctgcctcggtc
ttcagcctcctggccattgccatcgagagacaagtggccatcgccaaggtcaagctctac
ggcagtgacaaaagctgtcgaatgttgatgctcattggggcctcttggctgatatcgctg
attctgggtggcttgcccatcctgggctggaattgtctggaccatctggaggcttgctcc
actgtgctgcccctctatgctaagcactatgtgctctgcgtggtcaccatcttctctgtc
atcttactggctatcgtggccttgtacgtccgaatctacttcgtagtccgctcaagccat
gcggacgttgctggtcctcagacgctggccctgctcaagacagtcaccatcgtactgggt
gttttcatcatctgctggctgccggcttttagcatccttctcttagactctacctgtccc
gtccgggcctgtcctgtcctctacaaagcccattatttctttgccttcgccaccctcaac
tctctgctcaaccctgtcatctatacatggcgtagccgggaccttcggagggaggtactg
aggcccctgctgtgctggcggcaggggaagggagcaacagggcgcagaggtgggaaccct
ggtcaccgactcctgcccctccgcagctccagctccctggagagaggcttgcatatgcct
acatcgccaacatttctggagggcaacacagtggtctga

DBGET integrated database retrieval system