KEGG   Rattus norvegicus (rat): 29432Help
Entry
29432             CDS       T01003                                 

Gene name
Pak2, gamma-PAK
Definition
p21 protein (Cdc42/Rac)-activated kinase 2 (EC:2.7.11.1)
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    29432 (Pak2)
   04010 MAPK signaling pathway
    29432 (Pak2)
   04012 ErbB signaling pathway
    29432 (Pak2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    29432 (Pak2)
  Cellular commiunity
   04510 Focal adhesion
    29432 (Pak2)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    29432 (Pak2)
  Development
   04360 Axon guidance
    29432 (Pak2)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    29432 (Pak2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     29432 (Pak2)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   29432 (Pak2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
11q22
AA seq 524 aa AA seqDB search
MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSST
EKGSKKKEKERPEISPPSDFEYTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNP
QAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNTKGSETSAVVTEEDDDDEDAAP
PVIAPRPDHTKSIYTRSVIDPIPAPVGDSNVDSGAKSSDKQKKKAKMTDEEIMEKLRTIV
SIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLH
ANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTREAY
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRC
LEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgtctgataacggggagctagaggacaagcccccagcacctccagtgcggatgagcagc
accatttttagcactggaggaaaggatcctttatcagccaatcacagtttgaagcctttg
ccttctgttccagaggaaaaaaaaccgaggaacaaaatcatctccatattctcaagcaca
gaaaaaggaagtaaaaagaaagaaaaagaacggccagagatttctccgccgtctgatttt
gagtataccatccatgttggctttgatgctgttacgggagagttcactggcatgccagag
cagtgggcacggctgttgcagacctccaacattaccaaactggagcagaagaagaacccg
caggctgtgctggatgtcttgaagttctacgactccaacactgtgaagcagaagtacctg
agcttcactcctcctgagaaagatggctttccttctggaacaccagcactgaacaccaag
gggtcagagacatcagctgtggtgacagaggaagacgatgacgatgaagatgctgctcct
cccgtcattgcccctcggccagatcatacaaaatcaatctacacaaggtctgtcatcgac
cctattcctgctccagttggtgactctaatgtcgacagtggtgccaagtcttcagacaaa
cagaaaaagaaagccaagatgaccgatgaagagattatggagaaattaagaactattgtg
agcataggtgaccctaagaaaaaatacacaagatatgaaaaaatcgggcaaggggcttct
ggtacagtttttactgcaactgatgtggccctggggcaagaggttgctatcaagcagatt
aatttacagaaacaaccaaagaaggaattgatcattaatgaaattctggtgatgaaggag
ttaaagaatcccaacatagttaacttcttggacagttacctggtaggagacgagttgttt
gtggtaatggagtaccttgctggtgggtccctcactgatgtcgtgacagaaacctgcatg
gatgaagcgcagatcgcagctgtgtgcagagagtgtttacaggcgttggagtttttacat
gctaatcaagtgatccacagagacatcaaaagtgacaatgtgcttttgggaatggaaggc
tcagttaaactcactgattttggcttctgtgcccagatcacccctgaacagagcaaacgc
agtacaatggttggaacgccatactggatggcaccggaggtagtcacgcgggaagcctat
ggccccaaagttgacatatggtctctgggcatcatggctatcgaaatggtggaaggagag
cctccatacctcaatgaaaatcctttacgggcattatacctgatagcaacgaatggaaca
cctgagctccagaatccagaaaaactttcccccatatttcgggatttcttaaatcggtgt
ttggaaatggatgtggagaagaggggttcagccaaagaactattacagcatcctttcctg
aaactggccaaaccattatccagcttgacgcctctgatcctggcagctaaagaagcaatg
aagagtaaccgctaa

DBGET integrated database retrieval system