KEGG   Rattus norvegicus (rat): 29441Help
Entry
29441             CDS       T01003                                 

Gene name
Por, CYPOR
Definition
P450 (cytochrome) oxidoreductase (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     29441 (Por)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q12
AA seq 678 aa AA seqDB search
MGDSHEDTSATMPEAVAEEVSLFSTTDMVLFSLIVGVLTYWFIFRKKKEEIPEFSKIQTT
APPVKESSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLA
DLSSLPEIDKSLVVFCMATYGEGDPTDNAQDFYDWLQETDVDLTGVKFAVFGLGNKTYEH
FNAMGKYVDQRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEFFGVEATGEES
SIRQYELVVHEDMDVAKVYTGEMGRLKSYENQKPPFDAKNPFLAAVTANRKLNQGTERHL
MHLELDISDSKIRYESGDHVAVYPANDSALVNQIGEILGADLDVIMSLNNLDEESNKKHP
FPCPTTYRTALTYYLDITNPPRTNVLYELAQYASEPSEQEHLHKMASSSGEGKELYLSWV
VEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVAVEYEA
KSGRVNKGVATSWLRAKEPAGENGGRALVPMFVRKSQFRLPFKSTTPVIMVGPGTGIAPF
MGFIQERAWLREQGKEVGETLLYYGCRRSDEDYLYREELARFHKDGALTQLNVAFSREQA
HKVYVQHLLKRDREHLWKLIHEGGAHIYVCGDARNMAKDVQNTFYDIVAEFGPMEHTQAV
DYVKKLMTKGRYSLDVWS
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgggggactctcacgaagacaccagtgccaccatgcctgaggccgtggctgaagaagtg
tctctattcagcacgacggacatggttctgttttctctcatcgtgggggtcctgacctac
tggttcatctttagaaagaagaaagaagagataccggagttcagcaagatccaaacaacg
gccccacccgtcaaagagagcagcttcgtggaaaagatgaagaaaacgggaaggaacatt
atcgtattctatggctcccagacgggaaccgctgaggagtttgccaaccggctgtccaag
gatgcccaccgctacgggatgcggggcatgtccgcagaccctgaagagtatgacttggcc
gacctgagcagcctgcctgagatcgacaagtccctggtagtcttctgcatggccacatac
ggagagggcgaccccacggacaatgcgcaggacttctatgactggctgcaggagactgac
gtggacctcactggggtcaagtttgctgtatttggtcttgggaacaagacctatgagcac
ttcaatgccatgggcaagtatgtggaccagcggctggagcagcttggcgcccagcgcatc
tttgagttgggccttggtgatgatgacgggaacttggaagaggatttcatcacgtggagg
gagcagttctggccagctgtgtgcgagttctttggggtagaagccactggggaggagtcg
agcattcgccagtatgagctcgtggtccacgaagacatggacgtagccaaggtgtacacg
ggtgagatgggccgtctgaagagctacgagaaccagaaaccccccttcgatgctaagaat
ccattcctggctgctgtcaccgccaaccggaagctgaaccaaggcactgagcggcatcta
atgcacctggagttggacatctcagactccaagatcaggtatgaatctggagatcacgtg
gctgtgtacccagccaatgactcagccctggtcaaccagattggggagatcctgggagct
gacctggatgtcatcatgtctctaaacaatctcgatgaggagtcaaacaagaagcatccg
ttcccctgccccaccacctaccgcacggccctcacctactacctggacatcactaacccg
ccacgcaccaatgtgctctacgaactggcacagtacgcctcagagccctcggagcaggag
cacctgcacaagatggcgtcatcctcaggcgagggcaaggagctgtacctgagctgggtg
gtggaagcccggaggcacatcctagccatcctccaagactacccatcactgcggccaccc
atcgaccacctgtgtgagctgctgccacgcctgcaggcccgatactactccattgcctca
tcctccaaggtccaccccaactccgtgcacatctgtgccgtggccgtggagtacgaagcg
aagtctggccgagtgaacaagggggtggccactagctggcttcgggccaaggaaccagca
ggcgagaatggcggccgcgccctggtacccatgttcgtgcgcaaatctcagttccgcttg
cctttcaagtccaccacacctgtcatcatggtgggccccggcactgggattgcccctttc
atgggcttcatccaggaacgagcttggcttcgagagcaaggcaaggaggtgggagagacg
ctgctatactatggctgccggcgctcggatgaggactatctgtaccgtgaagagctagcc
cgcttccacaaggacggtgccctcacgcagcttaatgtggccttttcccgggagcaggcc
cacaaggtctatgtccagcaccttctgaagagagacagggaacacctgtggaagctgatc
cacgagggcggtgcccacatctatgtgtgcggggatgctcgaaatatggccaaagatgtg
caaaacacattctatgacattgtggctgagttcgggcccatggagcacacccaggctgtg
gactatgttaagaagctgatgaccaagggccgctactcactagatgtgtggagctag

DBGET integrated database retrieval system