KEGG   Rattus norvegicus (rat): 29465Help
Entry
29465             CDS       T01003                                 

Gene name
Trpv2, Vrl1
Definition
(RefSeq) transient receptor potential cation channel, subfamily V, member 2
  KO
K04971  
transient receptor potential cation channel subfamily V member 2
Organism
rno  Rattus norvegicus (rat)
Pathway
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    29465 (Trpv2)
Ion channels [BR:rno04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPV (Vanilloid)
   29465 (Trpv2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q23
AA seq 761 aa AA seqDB search
MTSASSPPAFRLETSDGDEEGNAEVNKGKQEPPPMESPFQREDRNSSPQIKVNLNFIKRP
PKNTSAPSQQEPDRFDRDRLFSVVSRGVPEELTGLLEYLRWNSKYLTDSAYTEGSTGKTC
LMKAVLNLQDGVNACIMPLLQIDKDSGNPKPLVNAQCIDEFYQGHSALHIAIEKRSLQCV
KLLVENGADVHLRACGRFFQKHQGTCFYFGELPLSLAACTKQWDVVTYLLENPHQPASLE
ATDSLGNTVLHALVMIADNSPENSALVIHMYDGLLQMGARLCPTVQLEEISNHQGLTPLK
LAAKEGKIEIFRHILQREFSGPYQPLSRKFTEWCYGPVRVSLYDLSSVDSWEKNSVLEII
AFHCKSPNRHRMVVLEPLNKLLQEKWDRLVSRFFFNFACYLVYMFIFTVVAYHQPSLDQP
AIPSSKATFGESMLLLGHILILLGGIYLLLGQLWYFWRRRLFIWISFMDSYFEILFLLQA
LLTVLSQVLRFMETEWYLPLLVLSLVLGWLNLLYYTRGFQHTGIYSVMIQKVILRDLLRF
LLVYLVFLFGFAVALVSLSREARSPKAPEDNNSTVTEQPTVGQEEEPAPYRSILDASLEL
FKFTIGMGELAFQEQLRFRGVVLLLLLAYVLLTYVLLLNMLIALMSETVNHVADNSWSIW
KLQKAISVLEMENGYWWCRRKKHREGRLLKVGTRGDGTPDERWCFRVEEVNWVAWEKTLP
TLSEDPSGPGITGNKKNPTSKPGKNSASEEDHLPLQVLQSP
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagcctccagccccccagctttcaggctggagacttccgatggagatgaagag
ggcaatgctgaggtgaacaaggggaagcaggaaccgccccccatggagtcaccattccag
agggaggaccggaattcctcccctcagatcaaagtgaacctcaacttcataaagagacct
cctaaaaacacttctgctcccagccagcaggagccagatcggtttgaccgtgaccgactc
ttcagtgtggtctcccggggtgtccccgaggaactgactggactgctagaatacctgcgc
tggaacagcaagtacctcactgactctgcatacacagaaggctccactggaaagacgtgc
ctgatgaaggctgtgctgaaccttcaggatggggtcaatgcctgcatcatgccgctgctg
cagattgacaaggattccggcaatcccaagcccctcgtcaatgcccagtgcatcgatgag
ttctaccaaggccacagtgcgctgcacatcgccatagagaagaggagcctgcagtgcgtg
aagctgctggtagagaatggagcggatgttcacctccgagcctgtggccgcttcttccaa
aagcaccaaggaacttgtttctattttggagagctacctctttctctggctgcgtgcacc
aagcagtgggatgtggtgacctacctcctggagaacccacaccagccggccagcctggag
gccaccgactccctgggcaacacagtcctgcatgctctggtaatgattgcagataactcg
cctgagaacagtgccctggtgatccacatgtacgacgggcttctacaaatgggggcgcgc
ctctgccccactgtgcagcttgaggaaatctccaaccaccaaggcctcacacccctgaaa
ctagccgccaaggaaggcaaaatcgagattttcaggcacattctgcagcgggaattctca
ggaccgtaccagcccctttcccgaaagtttactgagtggtgttacggtcctgtgcgggta
tcgctgtacgacctgtcctctgtggacagctgggaaaagaactcggtgctggagatcatc
gcttttcattgcaagagcccgaaccggcaccgcatggtggttttagaaccactgaacaag
cttctgcaggagaaatgggatcggctcgtctcaagattcttcttcaacttcgcctgctac
ttggtctacatgttcatcttcaccgtcgttgcctaccaccagccttccctggatcagcca
gccatcccctcatcaaaagcgacttttggggaatccatgctgctgctgggccacattctg
atcctgcttgggggtatttacctcttactgggccagctgtggtacttttggcggcggcgc
ctgttcatctggatctcattcatggacagctactttgaaatcctctttctccttcaggct
ctgctcacagtgctgtcccaggtgctgcgcttcatggagactgaatggtacctacccctg
ctagtgttatccctagtgctgggctggctgaacctgctttactacacacggggctttcag
cacacaggcatctacagtgtcatgatccagaaggtcatccttcgagacctgctccgtttc
ctgctggtctacctggtcttccttttcggctttgctgtagccctagtaagcttgagcaga
gaggcccgaagtcccaaagcccctgaagataacaactccacagtgacggaacagcccacg
gtgggccaggaggaggagccagctccatatcggagcattctggatgcctccctagagctg
ttcaagttcaccattggtatgggggagctggctttccaggaacagctgcgttttcgtggg
gtggtcctgctgttgctgttggcctacgtccttctcacctacgtcctgctgctcaacatg
ctcattgctctcatgagcgaaactgtcaaccacgttgctgacaacagctggagcatctgg
aagttgcagaaagccatctctgtcttggagatggagaatggttactggtggtgccggagg
aagaaacatcgtgaagggaggctgctgaaagtcggcaccaggggggatggtacccctgat
gagcgctggtgcttcagggtggaggaagtaaattgggttgcttgggagaagactcttccc
accttatctgaggatccatcagggccaggcatcactggtaataaaaagaacccaacctct
aaaccggggaagaacagtgcctcagaggaagaccatctgccccttcaggtcctccagtcc
ccctga

DBGET integrated database retrieval system