KEGG   Rattus norvegicus (rat): 29468Help
Entry
29468             CDS       T01003                                 

Gene name
Pdia3, ER60, ERp57, Grp58
Definition
protein disulfide isomerase family A, member 3 (EC:5.3.4.1)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Protein processing in endoplasmic reticulum
Antigen processing and presentation
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:rno04141]
Organismal Systems; Immune system; Antigen processing and presentation [PATH:rno04612]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
3q35
AA seq 505 aa AA seqDB search
MRFSCLALLPGVALLLASALLASASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT
ADGIVSHLKKQAGPASVPLRTEDEFKKFISDKDASVVGFFRDLFSDGHSEFLKAASNLRD
NYRFAHTNVESLVKEYDDNGEGITIFRPLHLANKFEDKIVAYTEKKMTSGKIKKFIQESI
FGLCPHMTEDNKDLIQGKDLLTAYYDVDYEKNTKGSNYWRNRVMMVAKTFLDAGHKLNFA
VASRKTFSHELSDFGLESTTGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQEYFDGN
LKRYLKSEPIPETNEGPVKVVVAESFDDIVNAEDKDVLIEFYAPWCGHCKNLEPKYKELG
EKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDLISYL
QREATNPPIIQEEKPKKKKKAQEDL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcagctgccttgcgctgctcccgggcgtggcgttgctgctcgcctcggccctc
ctcgcctccgcctcagacgtgttggaactgacggacgaaaacttcgagagtcgcgtctcc
gacacgggctcagctgggctcatgctagtcgagttcttcgccccatggtgtggacattgc
aagaggcttgcccctgagtatgaagctgcagcaaccagattaaaaggaatagtcccatta
gcaaaggtggactgcactgccaacacaaacacctgtaataagtatggcgtcagcggctac
ccaactcttaaaatatttagagatggtgaagaagcgggtgcttatgatgggcctaggact
gccgatggaattgtcagccacttgaagaaacaagcaggaccagcttcagttcctctcagg
actgaggacgaatttaagaagttcattagtgataaagatgcctcggtggtgggctttttc
agggatttattcagtgatggccactccgagttcctaaaagcagccagcaacttgagagat
aactaccgatttgcacacaccaacgttgaatctctggtgaaggagtacgatgataatgga
gaggggattactatatttcgtccattacatctggctaacaaatttgaagacaaaattgtg
gcatatactgaaaagaaaatgaccagtggcaaaatcaagaagtttattcaggaaagcatt
tttggtctctgtcctcatatgacagaagataataaagatttgatacaaggcaaggactta
ctcacggcttactatgatgtggactatgaaaagaatactaaaggttctaactactggaga
aacagggtcatgatggtggcaaagacattccttgatgctggacacaaactcaactttgct
gtagctagccgtaaaacctttagccatgaattgtctgactttggcttagaaagcactact
ggagagattcctgttgtggctatcagaactgctaaaggagagaagtttgtcatgcaggag
gagttctcgcgggatggcaaggctcttgagcggttcctgcaggaatactttgatggcaac
ttgaagagatacctgaagtctgaacctatccccgagaccaacgaaggacctgtcaaggtg
gtggtagcagagagttttgatgacatagtgaatgctgaagacaaggacgtgctgatcgag
ttttatgctccttggtgtggccactgtaagaacctggaacccaagtacaaagagctgggg
gagaaactcagcaaagacccaaatattgtcatagccaagatggatgccacagccaatgat
gtgccttctccatatgaagtcaagggttttcctaccatctacttctcaccagccaacaag
aagctaactccaaagaagtatgaaggtggccgtgaattaaatgatcttatcagctatcta
caacgagaagctacaaaccctcctataattcaagaagaaaaacctaagaagaagaagaag
gcacaagaggacctctaa

DBGET integrated database retrieval system