KEGG   Rattus norvegicus (rat): 29468Help
Entry
29468             CDS       T01003                                 

Gene name
Pdia3, ER60, ERp57, Grp58
Definition
protein disulfide isomerase family A, member 3 (EC:5.3.4.1)
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Protein processing in endoplasmic reticulum
Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    29468 (Pdia3)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    29468 (Pdia3)
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     29468 (Pdia3)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   29468 (Pdia3)
  Exosomal proteins of colorectal cancer cells
   29468 (Pdia3)
  Exosomal proteins of bladder cancer cells
   29468 (Pdia3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q35
AA seq 505 aa AA seqDB search
MRFSCLALLPGVALLLASALLASASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHC
KRLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRT
ADGIVSHLKKQAGPASVPLRTEDEFKKFISDKDASVVGFFRDLFSDGHSEFLKAASNLRD
NYRFAHTNVESLVKEYDDNGEGITIFRPLHLANKFEDKIVAYTEKKMTSGKIKKFIQESI
FGLCPHMTEDNKDLIQGKDLLTAYYDVDYEKNTKGSNYWRNRVMMVAKTFLDAGHKLNFA
VASRKTFSHELSDFGLESTTGEIPVVAIRTAKGEKFVMQEEFSRDGKALERFLQEYFDGN
LKRYLKSEPIPETNEGPVKVVVAESFDDIVNAEDKDVLIEFYAPWCGHCKNLEPKYKELG
EKLSKDPNIVIAKMDATANDVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDLISYL
QREATNPPIIQEEKPKKKKKAQEDL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcagctgccttgcgctgctcccgggcgtggcgttgctgctcgcctcggccctc
ctcgcctccgcctcagacgtgttggaactgacggacgaaaacttcgagagtcgcgtctcc
gacacgggctcagctgggctcatgctagtcgagttcttcgccccatggtgtggacattgc
aagaggcttgcccctgagtatgaagctgcagcaaccagattaaaaggaatagtcccatta
gcaaaggtggactgcactgccaacacaaacacctgtaataagtatggcgtcagcggctac
ccaactcttaaaatatttagagatggtgaagaagcgggtgcttatgatgggcctaggact
gccgatggaattgtcagccacttgaagaaacaagcaggaccagcttcagttcctctcagg
actgaggacgaatttaagaagttcattagtgataaagatgcctcggtggtgggctttttc
agggatttattcagtgatggccactccgagttcctaaaagcagccagcaacttgagagat
aactaccgatttgcacacaccaacgttgaatctctggtgaaggagtacgatgataatgga
gaggggattactatatttcgtccattacatctggctaacaaatttgaagacaaaattgtg
gcatatactgaaaagaaaatgaccagtggcaaaatcaagaagtttattcaggaaagcatt
tttggtctctgtcctcatatgacagaagataataaagatttgatacaaggcaaggactta
ctcacggcttactatgatgtggactatgaaaagaatactaaaggttctaactactggaga
aacagggtcatgatggtggcaaagacattccttgatgctggacacaaactcaactttgct
gtagctagccgtaaaacctttagccatgaattgtctgactttggcttagaaagcactact
ggagagattcctgttgtggctatcagaactgctaaaggagagaagtttgtcatgcaggag
gagttctcgcgggatggcaaggctcttgagcggttcctgcaggaatactttgatggcaac
ttgaagagatacctgaagtctgaacctatccccgagaccaacgaaggacctgtcaaggtg
gtggtagcagagagttttgatgacatagtgaatgctgaagacaaggacgtgctgatcgag
ttttatgctccttggtgtggccactgtaagaacctggaacccaagtacaaagagctgggg
gagaaactcagcaaagacccaaatattgtcatagccaagatggatgccacagccaatgat
gtgccttctccatatgaagtcaagggttttcctaccatctacttctcaccagccaacaag
aagctaactccaaagaagtatgaaggtggccgtgaattaaatgatcttatcagctatcta
caacgagaagctacaaaccctcctataattcaagaagaaaaacctaagaagaagaagaag
gcacaagaggacctctaa

DBGET integrated database retrieval system