KEGG   Rattus norvegicus (rat): 294744Help
Entry
294744            CDS       T01003                                 

Gene name
Gpx8, RGD1307506
Definition
glutathione peroxidase 8 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    294744 (Gpx8)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    294744 (Gpx8)
 Organismal Systems
  Endocrine system
   04918 Thyroid hormone synthesis
    294744 (Gpx8)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     294744 (Gpx8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q14
AA seq 209 aa AA seqDB search
MEPLGAYPLKCSGPKAKIFAVLLSMVLCTVMLFLLQLKFLKPRINSFYSFEVKDAKGRMV
SLEKFKGKASLVVNVASDCRFTDKSYETLRELHKEFGPYHFNVLAFPCNQFGESEPKSSK
EVESFARKNYGVTFPIFHKIKILGPEAEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKF
WRPEEPLEAIRPHVSQMIGQIILKKKEDL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggagcctctcggtgcctacccactaaaatgttccgggcccaaagcaaagatatttgca
gttttgctatctatggttctgtgcaccgtgatgctttttctccttcagttaaaattcctg
aagccgagaatcaacagcttctactcctttgaagtgaaggatgccaaaggaaggatggtg
tctctggaaaagttcaaaggcaaagcttccctagttgtaaacgtggctagtgactgccgg
ttcacagacaagagttacgagaccctcagggagctgcacaaggagtttgggccctatcac
ttcaacgtcctggctttcccgtgcaatcagtttggagaatcggagcccaagtccagcaag
gaggtagaatcttttgcaagaaaaaactacggagtcacattccccatcttccacaagatt
aagattttagggccggaagcagaacctgcgtttagatttcttgttgattcttccaagaag
gaaccaaggtggaacttttggaagtatctggtcaaccctgagggacaagtcgtgaagttc
tggaggccagaagaaccccttgaagccatcagacctcatgtgtcacaaatgattgggcaa
atcattcttaaaaagaaagaggatctatga

DBGET integrated database retrieval system