KEGG   Rattus norvegicus (rat): 29511Help
Entry
29511             CDS       T01003                                 

Gene name
Padi2, Pdi2
Definition
peptidyl arginine deiminase, type II (EC:3.5.3.15)
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     29511 (Padi2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q36
AA seq 665 aa AA seqDB search
MLRERTVRLQYGSRVEAVYVLGTQLWTDVYSAAPAGAKTFSLKHSEGVKVEVVRDGEAEE
VVTNGKQRWALSPSTTLRLSMAQASTEASSDKVTVNYYEEDGSAPIDQAGLFLTAIEISL
DVDADRDGEVEKNNPKKASWTWGPEGQGAILLVNCDRDTPWLPKEDCSDEKVYSKQDLQD
MSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRQKLYHVVK
YTGGSAELLFFVEGLRFPDESFSGLVSIHVSLLEYMAEDIPLTPIFTDTVTFRIAPWIMT
PNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYMNRGDRWIQDEIEFGYIEA
PHKGFPVVLDSPRDGNLKDFPIKQLLGPDFGYVTREPLFETVTSLDSFGNLEVSPPVTVN
GKAYPLGRILIGSSFPLSGGRRMTKVVRDFLQAQQVQAPVELYSDWLTVGHVDEFMTFVP
IPGKKEFRLLMASTSACYQLFREKQKEGHGEAIMFKGLGGMSSKRITINKILSNESLTQE
NQYFQRCLDWNRDILKKELALTEKDIIDLPALFKMDEDRQARAFFPNMVNMIVLDKDLGI
PKPFGPQVEEECCLETHVRGLLEPLGLACTFIDDISAYHKFLGEVHCGTNVRRKPFTFKW
WHMVP
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggagcggaccgtacggctgcaatacgggagccgcgtggaggcggtgtacgtg
ctgggcacgcagctctggaccgatgtctacagtgcagcgcctgctggggccaaaaccttc
agcctgaagcactcggagggtgtgaaagtagaggtcgtgcgcgatggagaggcagaggag
gtagtcaccaacggcaagcagcgttgggccctgtcacccagcaccacactgcgactcagc
atggcccaggccagcaccgaggccagcagcgacaaggtcaccgtcaactactatgaagag
gatggcagtgcccctattgaccaggctgggctcttcctcactgccattgagatctcactg
gatgtggacgcagaccgggacggagaagtggagaagaataatcctaagaaggcatcctgg
acctggggtcctgagggccagggggccatcctgctggtgaactgtgaccgagacacaccc
tggttgcccaaggaggactgcagtgatgaaaaggtctacagcaaacaagaccttcaggac
atgtctcagatgatcctgaggaccaaaggccctgaccgcctgcccgccgggtatgaaata
gtcctctacatttctatgtcggactcggacaaagtgggcgtgttctacgtggagaacccg
ttctttggccagcgctacatccacatcctgggccggcagaagctctaccacgtggtgaag
tacaccggtggctctgcagagttgctgttcttcgtggaaggcctccgtttcccagacgag
agtttctcaggcctggtttccatccacgtcagtctgctggagtatatggccgaggacatc
ccattgacacccatcttcacagacaccgtgacgttccggattgccccatggattatgaca
cccaacatcctgcctcccgtgtcagtgtttgtgtgctgcatgaaggacaattacctgttc
ctgaaagaggtgaagaacctggtggagaaaaccaactgcgagctgaaagtttgtttccag
tacatgaatcgtggcgaccgctggatccaggatgaaattgagtttggctacattgaggca
cctcacaaaggcttcccagtagtgctggactcccctcgagatggaaacctgaaggacttc
cccattaagcaactcctgggcccagatttcggctatgtgacccgggagcccctctttgag
actgtcaccagccttgactccttcgggaatctggaggtcagtcccccagtgaccgtgaat
ggcaaggcatacccgcttggccggatcctcatcgggagcagtttccctctgtctggaggc
aggaggatgaccaaggtggtgcgtgacttcctgcaggcccagcaggtgcaggcgcccgtg
gaactctactcggattggctgactgtgggccacgtcgatgagttcatgaccttcgtcccc
atcccaggcaaaaaggaatttcggctgctcatggccagcacctcagcctgctaccagctc
ttcagagaaaagcagaaggaaggccacggggaggccattatgttcaagggtctggggggc
atgagcagcaaacgaatcaccatcaataagatcctgtccaatgagagcctcacgcaggaa
aaccagtactttcagcgctgtctggattggaaccgtgacatccttaagaaggagctggct
ctgactgagaaggacatcattgacctgcctgctctcttcaagatggatgaagaccgtcag
gccagggctttcttccctaacatggtgaacatgatcgtgctagacaaggacctgggtatc
cccaagcctttcgggccccaggtcgaggaggagtgctgcctggagacacatgttcgaggc
ctgctggagcccctgggccttgcctgcaccttcattgatgacatctctgcataccacaag
tttctgggagaggttcactgtggcaccaacgtgcgcaggaagcccttcaccttcaagtgg
tggcacatggtgccctga

DBGET integrated database retrieval system