KEGG   Rattus norvegicus (rat): 29513Help
Entry
29513             CDS       T01003                                 

Gene name
Mapk13, Prkm13
Definition
(RefSeq) mitogen activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04015  Rap1 signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04714  Thermogenesis
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05132  Salmonella infection
rno05133  Pertussis
rno05140  Leishmaniasis
rno05142  Chagas disease (American trypanosomiasis)
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05164  Influenza A
rno05167  Kaposi's sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05205  Proteoglycans in cancer
rno05418  Fluid shear stress and atherosclerosis
Module
rno_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    29513 (Mapk13)
   04010 MAPK signaling pathway
    29513 (Mapk13)
   04370 VEGF signaling pathway
    29513 (Mapk13)
   04668 TNF signaling pathway
    29513 (Mapk13)
   04068 FoxO signaling pathway
    29513 (Mapk13)
   04071 Sphingolipid signaling pathway
    29513 (Mapk13)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    29513 (Mapk13)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    29513 (Mapk13)
 Organismal Systems
  Immune system
   04611 Platelet activation
    29513 (Mapk13)
   04620 Toll-like receptor signaling pathway
    29513 (Mapk13)
   04621 NOD-like receptor signaling pathway
    29513 (Mapk13)
   04622 RIG-I-like receptor signaling pathway
    29513 (Mapk13)
   04625 C-type lectin receptor signaling pathway
    29513 (Mapk13)
   04660 T cell receptor signaling pathway
    29513 (Mapk13)
   04658 Th1 and Th2 cell differentiation
    29513 (Mapk13)
   04659 Th17 cell differentiation
    29513 (Mapk13)
   04657 IL-17 signaling pathway
    29513 (Mapk13)
   04664 Fc epsilon RI signaling pathway
    29513 (Mapk13)
   04670 Leukocyte transendothelial migration
    29513 (Mapk13)
  Endocrine system
   04912 GnRH signaling pathway
    29513 (Mapk13)
   04914 Progesterone-mediated oocyte maturation
    29513 (Mapk13)
   04917 Prolactin signaling pathway
    29513 (Mapk13)
   04926 Relaxin signaling pathway
    29513 (Mapk13)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    29513 (Mapk13)
  Nervous system
   04728 Dopaminergic synapse
    29513 (Mapk13)
   04723 Retrograde endocannabinoid signaling
    29513 (Mapk13)
   04722 Neurotrophin signaling pathway
    29513 (Mapk13)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    29513 (Mapk13)
  Development
   04380 Osteoclast differentiation
    29513 (Mapk13)
  Environmental adaptation
   04714 Thermogenesis
    29513 (Mapk13)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    29513 (Mapk13)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    29513 (Mapk13)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    29513 (Mapk13)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    29513 (Mapk13)
  Infectious diseases
   05132 Salmonella infection
    29513 (Mapk13)
   05133 Pertussis
    29513 (Mapk13)
   05152 Tuberculosis
    29513 (Mapk13)
   05164 Influenza A
    29513 (Mapk13)
   05160 Hepatitis C
    29513 (Mapk13)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    29513 (Mapk13)
   05169 Epstein-Barr virus infection
    29513 (Mapk13)
   05145 Toxoplasmosis
    29513 (Mapk13)
   05140 Leishmaniasis
    29513 (Mapk13)
   05142 Chagas disease (American trypanosomiasis)
    29513 (Mapk13)
  Drug resistance
   01522 Endocrine resistance
    29513 (Mapk13)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     29513 (Mapk13)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   29513 (Mapk13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RIO1 APH Kdo Kinase-like Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 29513
NCBI-ProteinID: NP_062104
RGD: 3045
Ensembl: ENSRNOG00000000515
Vega: OTTRNOG00000001972
UniProt: Q32Q45
Position
20p12
AA seq 366 aa AA seqDB search
MSLIRKRGFYKQDINKTAWELPKTYLAPAHVGSGAYGAVCSAIDKRTGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMHHENVIGLLDVYTPATSVQNFQDFYLVMPFMQTDLQKIMGM
EFSEEKVQYLVYQMLKGLKYIHSAGIVHRDLKPGNLAVNEDCELKILDFGLARHTDAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGAEFVQKLKDKAAKSYIQSLPQSPKKDFTQLFPRASPQAVDLLDKMLELDVDKRLTAA
QALAHPFFEPFRDPEEETEAQQPFDDALEREKLSVDEWKQHIYKEIANFSPIARKDSRRR
SGMKLQ
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcattcggaaaaggggcttctacaagcaggacatcaacaagactgcctgggag
ctgcccaagacctacctggcgcccgcgcacgtcggcagcggggcctatggcgcggtgtgc
tcggccatcgacaagcggacaggggagaaggtggccatcaagaagctgagccggcccttc
cagtcggagatctttgccaagcgcgcttaccgcgaactcctgctgttgaagcacatgcac
catgagaacgtcattgggcttctggatgtctacacacctgccacttccgttcaaaacttc
caagatttctacctggtgatgcctttcatgcagaccgacctgcagaagataatggggatg
gagttcagtgaggagaaggtccagtatttggtgtaccagatgctcaaaggtctaaagtac
atccactcagctggtatcgttcacagggacctgaagccaggcaacctggccgtgaatgaa
gactgtgagctgaagatcctggactttgggctggcacgccacacggacgcggagatgact
ggctatgtggtgacccgctggtaccgggctcctgaggtgatcctcagctggatgcattac
aaccagacggtggatatctggtctgttggctgcatcatggccgagatgctaaccggaaag
acactcttcaagggtaaggactacctggaccagctgacccagatcctgaaagtgactggg
gtgccaggtgccgagttcgtgcagaagctgaaagacaaggcggccaaatcctacattcag
tccctgccccagagccccaagaaggatttcacacagcttttcccacgcgccagcccgcaa
gctgtagacctgctggacaagatgctggagctggacgtggacaagcgtctgaccgctgct
caggcactcgctcaccccttctttgaacccttccgggaccctgaggaggagacagaggcc
cagcagccatttgatgatgccttagagcgggagaaactcagcgtggacgaatggaaacaa
cacatctacaaagagatcgccaacttcagtcccatagcccggaaggactcgcggcgacga
agtgggatgaagctgcagtga

DBGET integrated database retrieval system