KEGG   Rattus norvegicus (rat): 29524Help
Entry
29524             CDS       T01003                                 

Gene name
Limk2, Limk2b, Link2
Definition
(RefSeq) LIM domain kinase 2
  KO
K05744  
LIM domain kinase 2 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Axon guidance
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    29524 (Limk2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    29524 (Limk2)
  Development
   04360 Axon guidance
    29524 (Limk2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     29524 (Limk2)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: TKL group
  LISK family [OT]
   29524 (Limk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
14q21
AA seq 638 aa AA seqDB search
MAALAGEEAWRCRGCGNYVPLSQRLYRTANEAWHSSCFRCSECQESLTNWYYEKDGKLYC
HKDYWAKFGEFCHGCSLLMTGPAMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLY
CGKCHNEVVLAPMFERLSTESVQDQLPYSVTLISMPATTECRRGFSVSVESASSNYATTV
QVKEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAINQTSQTLQLLIEHDPV
PQRLDQLRLDTRLSPHMQSSGHTLMLSTLDAKENQEGTLRRRSLRRSNSISKSPGPSSPK
EPLLLSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMK
ELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRNV
DPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEER
KRPPVEKAATKKRTLRKSDRKKRYTVVGNPYWMAPEMLNGKSYDETVDVFSFGIVLCEII
GQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCKLEPESRPAFSKLEDS
FEALSLFLGELAIPLPAELEELDHTVSMEYGLTRDSPP
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctggcgggtgaagaggcctggaggtgtcggggctgtggcaactatgttccc
ctgagccagaggctgtacaggacagccaacgaggcctggcatagctcctgcttccggtgt
tccgagtgccaggagtccctcaccaactggtactatgagaaggacgggaagctctactgc
cacaaggactactgggccaagtttggagaattctgccacgggtgctccctgctgatgaca
gggccagccatggtggctggggagtttaagtaccacccagagtgctttgcctgcatgagt
tgcaaggtgatcatcgaggatggggatgcgtacgccctggtgcagcatgctacactctac
tgcgggaagtgccacaatgaggtggtgctggcacccatgtttgaaagactgtctacggag
tctgtccaggaccagctgccctactctgtcacgctcatctccatgcctgccaccaccgag
tgcagacgtggcttctctgtgtctgtggaaagcgcctcctctaactatgccaccaccgtg
caagtgaaagaggtcaaccggatgcacatcagccccaacaaccgaaatgccatccacccc
ggggaccgcatcttggagatcaatgggacccctgtccgcactctccgagtagaagaggtg
gaggatgcgattaaccagacgagccagacacttcaactgctgattgaacatgaccctgtc
ccccagcgcctggaccagttacggctagacacccggctttctccccacatgcagagtagt
ggacatactctcatgctcagcaccttggacgccaaggaaaatcaggagggaacactgagg
agacgttctctgaggcgcagtaacagcatctccaagtctcctggccccagctcccccaag
gagccgctgctcctgagccgagacatcagtcgctcagagtcccttcgctgctccagcagc
tactcacagcagatcttccggccctgtgacctgatccacggggaggtcctggggaagggc
ttcttcggacaggccatcaaggtgactcacaaagccacaggcaaagtgatggtcatgaag
gagttaattcgctgtgatgaggaaacccagaagactttcctgactgaggtgaaagtgatg
cgaagcctggaccaccctaacgtgcttaagttcatcggggtcctgtacaaggacaagaag
ctgaatctgctgacagagtacattgaggggggcaccctgaaggactttctgcgcaatgtg
gacccgtttccctggcaacagaaggtcaggtttgccaaaggcatcgcttccggaatggct
tatttacactccatgtgcatcatccaccgagatctgaactcgcacaactgtctcatcaaa
ttggacaagacggtggtggtagcagacttcgggctgtcacgtctcatagtggaagagagg
aaaaggcctccagtagagaaggccgccaccaagaaacgcaccttacgcaagagtgatcgc
aagaagcgctacactgtggtgggaaacccctactggatggcccctgagatgctgaatggc
aagagctacgatgagactgtggatgtcttctcttttgggattgttctctgtgagatcatt
gggcaggtatatgctgatcccgactgccttccccgcacactggacttcggcctcaacgta
aagcttttctgggagaagtttgtcccaacagactgtcccccagccttcttccccctggct
gctatctgctgcaaactggagcctgagagcagaccggcattctcaaagctggaggactca
ttcgaggcgctctccctgttcttgggagagttggccatcccactgccagcagagctggaa
gagctggaccacactgtgagcatggagtatggcctaacccgggactcgccaccctag

DBGET integrated database retrieval system