KEGG   Rattus norvegicus (rat): 29545Help
Entry
29545             CDS       T01003                                 

Gene name
Uchl1
Definition
(RefSeq) ubiquitin C-terminal hydrolase L1
  KO
K05611  ubiquitin carboxyl-terminal hydrolase L1 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05012  Parkinson's disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    29545 (Uchl1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     29545 (Uchl1)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   29545 (Uchl1)
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    29545 (Uchl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C12
Motif
Other DBs
NCBI-GeneID: 29545
NCBI-ProteinID: NP_058933
RGD: 3928
Ensembl: ENSRNOG00000002343
UniProt: Q00981
Position
14p11
AA seq 223 aa AA seqDB search
MQLKPMEINPEMLNKVLAKLGVAGQWRFADVLGLEEETLGSVPSPACALLLLFPLTAQHE
NFRKKQIEELKGQEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLEFEDGSVLKQFLSE
TEKLSPEDRAKCFEKNEAIQAAHDSVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMP
FPVNHGASSEDSLLQDAAKVCREFTEREQGEVRFSAVALCKAA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgaaaccgatggagattaaccccgagatgctgaacaaagtgttggccaagctg
ggggtcgccgggcagtggcgctttgccgacgtgctagggctggaggaggagactctgggc
tcagtgccatctcctgcctgcgccctgctgctgctgtttcccctcacggcccagcatgaa
aacttcaggaaaaaacaaattgaggaactgaagggacaagaagttagccctaaagtttac
ttcatgaagcagaccatcgggaactcctgtggtaccattgggctgatccacgcagtggcc
aataaccaagacaagctggaatttgaggatggatcagtcctgaaacagtttctgtctgaa
acggagaagttgtcccctgaagacagagccaagtgtttcgagaagaacgaggccattcag
gcagcccatgactccgtggcccaggagggccagtgccgggtagacgacaaagtgaatttc
cattttatcctgttcaataatgtggacggccacctctacgagctcgatgggcgaatgcct
ttcccggtgaaccatggcgccagttcagaggactctctgctgcaggatgccgccaaggtc
tgcagagaattcactgagcgcgagcagggagaggtccgcttctccgcagtggctctctgc
aaagcagcctaa

DBGET integrated database retrieval system