KEGG   Rattus norvegicus (rat): 295458Help
Entry
295458            CDS       T01003                                 

Gene name
Bdh2, Dhrs6
Definition
3-hydroxybutyrate dehydrogenase, type 2 (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rno00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:rno00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q43
AA seq 255 aa AA seqDB search
MFLDCTAGSTMGRLEGKVIVLTAAAQGIGRASALAFAREGAKVIATDINEAKLQELENYP
GIQTRVLDVTKKRQIDQFASEIEKIDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMY
LMIKAFLPKMLAQKSGNIINMSSVASSIKGVENRCVYSATKAAVIGLTKSVAADFIQQGI
RCNCVCPGTVDTPSLQERIQARDDPKEALKAFLNRQKTGRFASAEEVALLCVYLASDESA
YVTGTPVVIDGGWSL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtttttggattgcactgcaggatccaccatgggccgcctggaagggaaagtcatcgtc
ctgacagctgccgctcaagggatcggccgggcttctgctttagctttcgcaagagaagga
gccaaagtcatagccacagatatcaacgaggccaaactccaggagctggaaaattaccca
ggtattcaaactcgagtccttgatgtcacaaagaagagacaaattgatcagttcgcctca
gaaattgagaagattgatgttctctttaacgttgctggttttgtccaccacggaaccatc
ctggattgcgaggaaaaagactgggacttctccatgaatctcaacgtccgcagcatgtac
ctgatgatcaaggcattcctgcccaaaatgcttgctcagaaatctggcaacattatcaac
atgtcttccgtggcctccagcatcaaaggggtggagaacagatgtgtgtacagtgcaacc
aaggcagctgtgatcggcctcaccaagtccgtggctgcagacttcatccagcagggcatc
agatgcaactgtgtgtgcccaggaacggttgacaccccatctctgcaagaaagaatacaa
gccagagatgatcccaaagaggcactgaaagctttcctaaacagacagaagaccggaagg
tttgcatctgcagaagaggtcgccctgctctgcgtatacttggcctcagatgagtcagcc
tatgtgactggcacccctgtcgtcatcgatggcggttggagtctgtga

DBGET integrated database retrieval system