KEGG   Rattus norvegicus (rat): 295458Help
Entry
295458            CDS       T01003                                 

Gene name
Bdh2, Dhrs6
Definition
3-hydroxybutyrate dehydrogenase, type 2 (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    295458 (Bdh2)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    295458 (Bdh2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     295458 (Bdh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q43
AA seq 255 aa AA seqDB search
MFLDCTAGSTMGRLEGKVIVLTAAAQGIGRASALAFAREGAKVIATDINEAKLQELENYP
GIQTRVLDVTKKRQIDQFASEIEKIDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMY
LMIKAFLPKMLAQKSGNIINMSSVASSIKGVENRCVYSATKAAVIGLTKSVAADFIQQGI
RCNCVCPGTVDTPSLQERIQARDDPKEALKAFLNRQKTGRFASAEEVALLCVYLASDESA
YVTGTPVVIDGGWSL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtttttggattgcactgcaggatccaccatgggccgcctggaagggaaagtcatcgtc
ctgacagctgccgctcaagggatcggccgggcttctgctttagctttcgcaagagaagga
gccaaagtcatagccacagatatcaacgaggccaaactccaggagctggaaaattaccca
ggtattcaaactcgagtccttgatgtcacaaagaagagacaaattgatcagttcgcctca
gaaattgagaagattgatgttctctttaacgttgctggttttgtccaccacggaaccatc
ctggattgcgaggaaaaagactgggacttctccatgaatctcaacgtccgcagcatgtac
ctgatgatcaaggcattcctgcccaaaatgcttgctcagaaatctggcaacattatcaac
atgtcttccgtggcctccagcatcaaaggggtggagaacagatgtgtgtacagtgcaacc
aaggcagctgtgatcggcctcaccaagtccgtggctgcagacttcatccagcagggcatc
agatgcaactgtgtgtgcccaggaacggttgacaccccatctctgcaagaaagaatacaa
gccagagatgatcccaaagaggcactgaaagctttcctaaacagacagaagaccggaagg
tttgcatctgcagaagaggtcgccctgctctgcgtatacttggcctcagatgagtcagcc
tatgtgactggcacccctgtcgtcatcgatggcggttggagtctgtga

DBGET integrated database retrieval system