KEGG   Rattus norvegicus (rat): 296117Help
Entry
296117            CDS       T01003                                 

Gene name
Galk2
Definition
galactokinase 2 (EC:2.7.1.157)
Orthology
K00849  
galactokinase [EC:2.7.1.6]
Organism
rno  Rattus norvegicus (rat)
Pathway
Galactose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, galactose => UDP-galactose
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rno00052]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rno00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q36
AA seq 458 aa AA seqDB search
MAAEDPATRRVQVAEHPRLLKLKEMFNSKFGSTPKFYVRAPGRVNIIGEHIDYCGYSVLP
MAVEQDMLIAVGPVKTQTLQLANTDPLYPDFSTTANNICIDKTQPLWHNYFLCGFKGIQE
HFGLTQLPGMNCLVDGNIPPSSGLSSSSALVCCAGLVTLTVLGMRLSKVELAEICAKSER
YIGTEGGGMDQSISFLAEEGTAKLIEFSPLRATDVKLPSGAVFVIANSCVEMNKAATSHF
NVRVMECRLAAKVLAKHKGLQWDKVLRLEEVQSELGISLEEMLLVTEDALHAEPYSREEI
CKCLGISLEELRTQILSPNTQGELTFKLYQRAKHVYSEAARVLQFKQVCEAAPDNAVQLL
GELMNQSHRSCRDMYECSCPELDQLVDICRKFGAKGSRLTGAGWGGCTVSLVPADTLSSF
LASVHEAYYQGNMSRLAREKHSLFATKPGGGALVFLEA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggaggaccccgccacgcgacgagtccaagtggcagaacaccccagattgctg
aagctaaaagagatgttcaactctaagtttgggtccacacccaagttttatgttcgagcc
ccaggaagagtgaacataataggtgagcacatagattactgtgggtactctgttctcccc
atggctgtggagcaggacatgctaatagctgtgggacctgtgaaaacccagactctccaa
ctggccaatacagaccccttgtatccagacttcagtactacagctaataacatctgtatc
gacaagacccaacctctatggcacaactacttcctatgtggatttaagggaattcaggaa
cactttggtcttactcagctgcctggaatgaattgcctggtggatggaaatatacccccg
agttcaggcctctccagctccagtgctctggtttgctgcgctgggttagtgactctcaca
gtgctgggaatgagactatccaaggtggaacttgcagaaatctgtgccaagagtgagcgt
tacataggcaccgaaggcggaggcatggaccagtccatatcatttcttgcagaagaagga
actgccaagttaatagaatttagtcctctgagagcgactgatgtgaagctccccagtgga
gcagtcttcgtgattgccaacagctgtgtggaaatgaacaaggcagccacttcacatttc
aacgtcagggtgatggagtgtcggctggcggcaaaggtccttgctaaacacaaaggcttg
caatgggataaagtcctgaggctagaggaagtacaaagcgaactaggaattagtctggaa
gagatgctattggtcacagaggatgcccttcatgcagaaccctactcaagggaggagatc
tgtaagtgcctgggaattagcctggaggaactccgcacccaaatcctgagtccaaatact
caaggcgaactcaccttcaagctctaccagcgggccaagcatgtgtacagtgaggctgca
cgtgtgctgcagttcaagcaggtgtgcgaagcagcaccagacaacgccgtccagctgctg
ggcgagctgatgaaccagagccacagaagctgccgggacatgtatgagtgcagctgcccg
gaattggatcagctagtggacatctgccggaagtttggggccaaaggctcacgacttact
ggagccggatggggaggctgcactgtgtccctcgtgcctgctgacacgctgtccagcttc
ctcgcaagcgtgcatgaggcttactaccaggggaacatgtcccgcctggctcgggagaag
catagcttgtttgctaccaagcctggaggtggggccttggttttccttgaggcctaa

DBGET integrated database retrieval system