KEGG   Rattus norvegicus (rat): 296117Help
Entry
296117            CDS       T01003                                 

Gene name
Galk2
Definition
galactokinase 2 (EC:2.7.1.157)
Orthology
K18674  
N-acetylgalactosamine kinase [EC:2.7.1.157]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.157  N-acetylgalactosamine kinase
     296117 (Galk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q36
AA seq 458 aa AA seqDB search
MAAEDPATRRVQVAEHPRLLKLKEMFNSKFGSTPKFYVRAPGRVNIIGEHIDYCGYSVLP
MAVEQDMLIAVGPVKTQTLQLANTDPLYPDFSTTANNICIDKTQPLWHNYFLCGFKGIQE
HFGLTQLPGMNCLVDGNIPPSSGLSSSSALVCCAGLVTLTVLGMRLSKVELAEICAKSER
YIGTEGGGMDQSISFLAEEGTAKLIEFSPLRATDVKLPSGAVFVIANSCVEMNKAATSHF
NVRVMECRLAAKVLAKHKGLQWDKVLRLEEVQSELGISLEEMLLVTEDALHAEPYSREEI
CKCLGISLEELRTQILSPNTQGELTFKLYQRAKHVYSEAARVLQFKQVCEAAPDNAVQLL
GELMNQSHRSCRDMYECSCPELDQLVDICRKFGAKGSRLTGAGWGGCTVSLVPADTLSSF
LASVHEAYYQGNMSRLAREKHSLFATKPGGGALVFLEA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggaggaccccgccacgcgacgagtccaagtggcagaacaccccagattgctg
aagctaaaagagatgttcaactctaagtttgggtccacacccaagttttatgttcgagcc
ccaggaagagtgaacataataggtgagcacatagattactgtgggtactctgttctcccc
atggctgtggagcaggacatgctaatagctgtgggacctgtgaaaacccagactctccaa
ctggccaatacagaccccttgtatccagacttcagtactacagctaataacatctgtatc
gacaagacccaacctctatggcacaactacttcctatgtggatttaagggaattcaggaa
cactttggtcttactcagctgcctggaatgaattgcctggtggatggaaatatacccccg
agttcaggcctctccagctccagtgctctggtttgctgcgctgggttagtgactctcaca
gtgctgggaatgagactatccaaggtggaacttgcagaaatctgtgccaagagtgagcgt
tacataggcaccgaaggcggaggcatggaccagtccatatcatttcttgcagaagaagga
actgccaagttaatagaatttagtcctctgagagcgactgatgtgaagctccccagtgga
gcagtcttcgtgattgccaacagctgtgtggaaatgaacaaggcagccacttcacatttc
aacgtcagggtgatggagtgtcggctggcggcaaaggtccttgctaaacacaaaggcttg
caatgggataaagtcctgaggctagaggaagtacaaagcgaactaggaattagtctggaa
gagatgctattggtcacagaggatgcccttcatgcagaaccctactcaagggaggagatc
tgtaagtgcctgggaattagcctggaggaactccgcacccaaatcctgagtccaaatact
caaggcgaactcaccttcaagctctaccagcgggccaagcatgtgtacagtgaggctgca
cgtgtgctgcagttcaagcaggtgtgcgaagcagcaccagacaacgccgtccagctgctg
ggcgagctgatgaaccagagccacagaagctgccgggacatgtatgagtgcagctgcccg
gaattggatcagctagtggacatctgccggaagtttggggccaaaggctcacgacttact
ggagccggatggggaggctgcactgtgtccctcgtgcctgctgacacgctgtccagcttc
ctcgcaagcgtgcatgaggcttactaccaggggaacatgtcccgcctggctcgggagaag
catagcttgtttgctaccaagcctggaggtggggccttggttttccttgaggcctaa

DBGET integrated database retrieval system