KEGG   Rattus norvegicus (rat): 296121Help
Entry
296121            CDS       T01003                                 

Gene name
Usp8
Definition
ubiquitin specific peptidase 8 (EC:3.4.19.12)
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:rno04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q36
AA seq 1081 aa AA seqDB search
MPAVASVPKELYLSSSLKDLNKKTEVKPEKTSTKNYIHSAQKIFKAAEECRLDRDEERAY
VLYMKYVAVYNLIKKRPDFKQQQDYYLSILGPANIKKAIEEAERLSESLKLRYEEAEVRK
QLEEKDRREEEQLQQQKRQEMGREDSGAAAKRSVENLLDSKTKIQRVNGEKSEGGAAAER
GAVTAKELYTMMMDKNTSLIIMDARKIQDYQHSCILGSLSVPEEAISPGVTANWIEAKLS
DDSKDTWKKRGSVDYVVLLDWFSSAKDLLLGTTLRSLKDALFKWESKAVLHHEPLVLEGG
YENWLLCYPQFTTNAKVTPPPRSRPEEVSVSLDFTYPSLEEPVPSKLPAQMPPPPLEANE
KAQLVTDQDGKPRPLVQSALAGPSVAPKAEASPIIQPVPATKNVPQVDRTKKPAVKLPED
HRMKSESTDQSGRVLSDRSTKPVFTSPATMLTDEEKARIHEETALLMEKNRQEKELWERQ
QKEQKEKLRREEQERKAGKTQDAEERDFTENQHKAKDGQEKRDSKQTKAEDREPPADGAQ
DATGTQRQSKSEHDASDAKVSVEGKRCPMSEVQKRPADVSSASSMSGELSAGKAQREPLT
RARSEEMGRIVPGLPLGWAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSVPPSTPPTHK
VKPQIPAERDREPSKLKRSYSSPDITQALQEEEKRRPAVTPTVNRENKPPCYPKAEISRL
SASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRS
NLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKVTIGKINDQFAGSSQQDSQELLLFLM
DGLHEDLNKADNRKRHKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCL
TCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKK
IEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKSSLKKYNLFSVS
NHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVRSSAAYILFYTSLGPRVTEAA
T
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgtagcttcagttcctaaagaactctacctcagttcttcactcaaagacctc
aataagaagacagaagttaaacctgagaaaaccagcaccaagaattatatacacagcgct
cagaagattttcaaggcagcagaagaatgcagactagatcgtgatgaggaaagggcctat
gtgctttatatgaaatatgtggcggtttataatcttatcaaaaagagacctgatttcaag
caacagcaggactattacctttcaatacttggacctgcaaacatcaaaaaggctattgaa
gaagctgaaagactctctgagagcctcaaactgagatacgaagaggctgaagttcggaaa
cagcttgaagaaaaggacagacgggaggaagaacagctgcagcaacagaaaaggcaggag
atgggaagagaggatagtggtgcggcggccaaacgctccgtggaaaatttactggattcc
aaaaccaaaatccaaagggtcaatggagagaagagcgaaggaggtgcagcagcagagaga
ggagcagtcacagcaaaggagctatatacaatgatgatggataaaaacacaagcctgatt
ataatggatgctcggaaaatacaggattatcagcattcctgtatcttgggctctctcagt
gttcctgaagaagctatcagtccaggagtcactgccaattggattgaagcaaagctttca
gatgattctaaagacacgtggaaaaaaagggggagtgtggactatgtggtcctgctggac
tggtttagttcagcgaaagatttgctgctcgggaccacgctacggagtctgaaagatgct
cttttcaagtgggaaagtaaagctgtcctgcaccatgagcccttggtgctggagggcggc
tatgagaactggctcctgtgctatccacagttcacaacaaatgctaaggttactccaccc
cctcggagcaggcctgaagaggtgtctgtctcattggattttacttatccctcactggaa
gaaccagttccttccaaacttcctgcccagatgccacctcctcctttagaagcaaatgag
aaggcacagttggtaactgatcaagatggtaaaccgagaccgttagtccagtcggctcta
gccggacccagtgtggctcccaaagctgaagcttcacccataattcagccagtgcctgct
acaaagaatgttccacaggttgatcgtacaaaaaaaccagcagttaagttgcctgaagat
catagaatgaaatctgaaagtacagatcagagtggaagagttctttctgaccgatccacc
aagccagtatttacctctccagccaccatgctaacagatgaagaaaaggctcgcattcat
gaagaaacagcccttcttatggaaaagaatagacaggagaaggaactgtgggaaaggcag
cagaaggaacagaaagagaagctgagaagggaggaacaagagcgcaaagctggaaagacc
caggatgcagaagaacgggacttcactgagaatcagcacaaagcaaaggatggacaagag
aagagagacagcaaacagaccaaggcagaagacagagagcccccagcagatggggcccag
gacgccacaggaacgcaaagacaaagtaagagtgaacacgatgcttccgatgctaaggta
tctgtggaaggtaaaaggtgtcccatgtcagaagtgcagaagaggccagcagatgtgtcg
tctgcatcctccatgtcgggagagctgagtgcaggcaaggctcagcgagaacctttgaca
agagcaagaagtgaagaaatggggagaattgtgccaggactgcctttaggctgggccaag
tttcttgatccaatcactgggacttttcgttactaccattcacccacaaacacggttcac
atgtatccgcctgagatggctccttcgtctgtgcctccttccacccctcccactcacaaa
gtcaagccccagatccctgctgagcgggacagggagccatccaaactgaagcgctcctac
tcctcaccagacatcactcaggccctgcaggaggaggagaagaggaggccagcagtgacc
ccgacagtcaaccgggagaacaagccgccgtgttaccctaaagctgagatctcgaggctt
tctgcttctcagattcggaacctcaatcccgtttttggaggatctggaccagctcttact
ggacttcgtaatttgggaaatacttgttacatgaactcaatattacagtgcctgtgcaat
gctccacatttggctgattatttcaaccgaaactgctaccaggacgatatcaacaggtca
aatttgttggggcataaaggtgaagtggcagaagaatttggtataatcatgaaggcactg
tggacaggacagtatagatacatcagtccaaaagactttaaagtcaccattggtaagatt
aatgaccagtttgcaggatccagccagcaagattcacaagagctgctgcttttcctcatg
gatggcctccacgaggatctaaataaggctgacaatcggaagaggcataaggaagagaac
aatgaccacctcgatgactttaaagcggcagaacatgcctggcagaagcacaagcagctc
aatgagtccattattgtcgcactctttcagggtcagttcaaatccacagtgcagtgcctc
acctgtcacaagaagtctcggacattcgaggctttcatgtatttgtctttgccactagca
tccacaagtaaatgtactttacaggactgccttagattattttccaaagaagaaaagctt
acagataacaacagattttactgcagccattgccgagctcggcgggattctctaaagaaa
atagaaatctggaaattgcctcctgtgctgttagtacacctgaaacgattctcctatgac
ggcaggtggaagcagaaactgcaaacgtccgtggatttcccattagaaaatcttgacctg
tcacagtatgttattggcccaaaaagcagtttgaagaaatataacttgttttctgtttca
aaccactacggcgggctcgatggaggccactacacggcctattgtaaaaacgcggcgagg
cagcgctggtttaagtttgatgaccacgaggtttcggacatctccgtgtcttctgtgagg
tcgtcagcagcttatatcctgttttacacctccctggggccacgcgtgactgaggcagcc
acataa

DBGET integrated database retrieval system