KEGG   Rattus norvegicus (rat): 29629Help
Entry
29629             CDS       T01003                                 

Gene name
Gria4, GluA4, GluR-D, GluR4
Definition
glutamate receptor, ionotropic, AMPA 4
Orthology
K05200  
glutamate receptor 4
Organism
rno  Rattus norvegicus (rat)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Amphetamine addiction
Nicotine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    29629 (Gria4)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    29629 (Gria4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    29629 (Gria4)
   04728 Dopaminergic synapse
    29629 (Gria4)
   04723 Retrograde endocannabinoid signaling
    29629 (Gria4)
  Environmental adaptation
   04713 Circadian entrainment
    29629 (Gria4)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    29629 (Gria4)
   05033 Nicotine addiction
    29629 (Gria4)
Ion channels [BR:rno04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   29629 (Gria4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q11
AA seq 902 aa AA seqDB search
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDMPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGL
LDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD
LP
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttgcaggcagattgtcttgttgttttctggattttggggactcgccatg
ggagcctttccaagcagcgttcaaataggtggtctcttcatccgaaacacagaccaggaa
tacactgcttttagactggcaatctttcttcataacaccagccccaatgcatcggaagct
cctttcaatttggtacctcatgtggacaacattgagactgccaacagttttgctgtgaca
aacgccttctgttcccagtattctagaggggtgtttgccatttttggactctatgacaag
agatccgtgcataccttgacctcgttctgcagtgctctgcacatctctctcatcacacca
agctttcccactgaaggggagagccagtttgtgctgcagctaagaccttcactgagaggt
gcactcctgagcctcctggatcactatgagtggaactgtttcgtcttcctgtatgataca
gacagggggtattcaatacttcaagctataatggaaaaagcaggacaaaatggatggcat
gtcagtgcaatatgtgtggaaaattttaatgatgtcagctacaggcaactgctagaagag
cttgacagaagacaagagaagaaatttgtgatagattgtgagatagagaggcttcaaaac
attttagaacaaattgtgagtgttgggaagcatgtcaaaggctaccattatatcatcgca
aatttgggtttcaaggatatttctcttgagagatttatacatggaggagcaaatgtaaca
ggattccagttggtagattttaatacacccatggtaaccaaactaatggatcggtggaag
aaactagatcagagagaatatccaggttctgaaacacctccaaagtacacctctgctctc
acttatgatggagtcctggtgatggctgaaactttccgaagtctcagaagacagaaaatt
gatatttcaaggagaggaaatgctggggactgtctggcaaaccctgctgctccctggggc
cagggaattgacatggagaggacactgaagcaggttcgaattcaagggctgactgggaat
gttcaatttgaccattatggacgtagagttaattacacaatggatgtgtttgaactgaaa
agcacaggacctcgaaaggttggctactggaatgatatggataaattagtcttgattcaa
gatatgcctactcttggcaatgacacagcagctattgagaacagaacagtggttgtaacc
acaattatggaatctccctatgttatgtacaagaaaaatcatgaaatgtttgaaggaaat
gacaagtacgaaggctactgtgtagatctggcatcggaaattgcaaaacatattggtatc
aaatataaaattgccattgttcctgatggaaaatatggagcaagggacgcagacactaag
atctggaatgggatggtaggagagcttgtgtatgggaaagcagagattgctattgcccct
ctgacaatcacattggttcgagaggaagtcatcgatttttctaagccttttatgagttta
ggcatctctatcatgatcaaaaaacctcagaaatctaaaccaggagtcttttccttcttg
gaccctctggcctatgagatctggatgtgcatagtgtttgcatacattggtgtcagtgtg
gtcttgttcctagtcagtaggtttagcccatatgagtggcacacagaagaacctgaggat
gggaaggaaggacccagtgaccagcctcccaatgaatttggcatctttaacagcctttgg
ttttccctgggtgcctttatgcaacaaggatgtgacatttcacccagatccctgtcaggt
cggattgttggaggcgtgtggtggttcttcacactcatcattatatcgtcctacactgct
aatctggctgcattccttactgtggagagaatggtctcccccatagaaagtgcagaagac
ctggccaaacaaacagaaattgcctatggaacacttgattctgggtcaacaaaagaattc
ttcagaagatcaaaaatagcagtgtatgaaaagatgtggacctacatgcgatcggcagag
ccgtctgtgttcactagaactacagctgagggcgtggctcgtgtccgcaagtccaagggc
aaatttgcctttctcctggagtccacgatgaatgaatacattgagcagcgaaagccctgt
gacacgatgaaagtgggaggaaacctggattccaaaggctatggtgtagcaacgcccaag
ggttcctcattaagaaatgctgttaacctcgcagttttaaaactgaatgaacaaggcctc
ttggacaaattgaaaaacaaatggtggtacgacaaaggagaatgtggcagcgggggaggt
gactccaaggacaagacgagtgccttgagcctgagcaacgtagcaggcgtcttctacatt
ctggttggcggcctgggcttggcaatgctggtggctttgatagagttctgttacaagtcc
agggcagaggcgaagagaatgaagctgactttttccgaagccataagaaacaaagccagg
ttatccatcactgggagtgtgggagaaaacggccgtgtgctgacccctgactgccccaag
gccgtacacacaggaactgcaattagacaaagttcgggattggctgtcattgcatcggac
ctaccataa

DBGET integrated database retrieval system