KEGG   Rattus norvegicus (rat): 29629Help
Entry
29629             CDS       T01003                                 

Gene name
Gria4, GluA4, GluR-D, GluR4
Definition
glutamate receptor, ionotropic, AMPA 4
Orthology
K05200  
glutamate receptor 4
Organism
rno  Rattus norvegicus (rat)
Pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Amphetamine addiction
Nicotine addiction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:rno04080]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:rno04724]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:rno04728]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:rno04723]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:rno04713]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:rno05031]
Human Diseases; Substance dependence; Nicotine addiction [PATH:rno05033]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Structure
PDB: 

Jmol
Position
8q11
AA seq 902 aa AA seqDB search
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDMPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGL
LDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD
LP
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttgcaggcagattgtcttgttgttttctggattttggggactcgccatg
ggagcctttccaagcagcgttcaaataggtggtctcttcatccgaaacacagaccaggaa
tacactgcttttagactggcaatctttcttcataacaccagccccaatgcatcggaagct
cctttcaatttggtacctcatgtggacaacattgagactgccaacagttttgctgtgaca
aacgccttctgttcccagtattctagaggggtgtttgccatttttggactctatgacaag
agatccgtgcataccttgacctcgttctgcagtgctctgcacatctctctcatcacacca
agctttcccactgaaggggagagccagtttgtgctgcagctaagaccttcactgagaggt
gcactcctgagcctcctggatcactatgagtggaactgtttcgtcttcctgtatgataca
gacagggggtattcaatacttcaagctataatggaaaaagcaggacaaaatggatggcat
gtcagtgcaatatgtgtggaaaattttaatgatgtcagctacaggcaactgctagaagag
cttgacagaagacaagagaagaaatttgtgatagattgtgagatagagaggcttcaaaac
attttagaacaaattgtgagtgttgggaagcatgtcaaaggctaccattatatcatcgca
aatttgggtttcaaggatatttctcttgagagatttatacatggaggagcaaatgtaaca
ggattccagttggtagattttaatacacccatggtaaccaaactaatggatcggtggaag
aaactagatcagagagaatatccaggttctgaaacacctccaaagtacacctctgctctc
acttatgatggagtcctggtgatggctgaaactttccgaagtctcagaagacagaaaatt
gatatttcaaggagaggaaatgctggggactgtctggcaaaccctgctgctccctggggc
cagggaattgacatggagaggacactgaagcaggttcgaattcaagggctgactgggaat
gttcaatttgaccattatggacgtagagttaattacacaatggatgtgtttgaactgaaa
agcacaggacctcgaaaggttggctactggaatgatatggataaattagtcttgattcaa
gatatgcctactcttggcaatgacacagcagctattgagaacagaacagtggttgtaacc
acaattatggaatctccctatgttatgtacaagaaaaatcatgaaatgtttgaaggaaat
gacaagtacgaaggctactgtgtagatctggcatcggaaattgcaaaacatattggtatc
aaatataaaattgccattgttcctgatggaaaatatggagcaagggacgcagacactaag
atctggaatgggatggtaggagagcttgtgtatgggaaagcagagattgctattgcccct
ctgacaatcacattggttcgagaggaagtcatcgatttttctaagccttttatgagttta
ggcatctctatcatgatcaaaaaacctcagaaatctaaaccaggagtcttttccttcttg
gaccctctggcctatgagatctggatgtgcatagtgtttgcatacattggtgtcagtgtg
gtcttgttcctagtcagtaggtttagcccatatgagtggcacacagaagaacctgaggat
gggaaggaaggacccagtgaccagcctcccaatgaatttggcatctttaacagcctttgg
ttttccctgggtgcctttatgcaacaaggatgtgacatttcacccagatccctgtcaggt
cggattgttggaggcgtgtggtggttcttcacactcatcattatatcgtcctacactgct
aatctggctgcattccttactgtggagagaatggtctcccccatagaaagtgcagaagac
ctggccaaacaaacagaaattgcctatggaacacttgattctgggtcaacaaaagaattc
ttcagaagatcaaaaatagcagtgtatgaaaagatgtggacctacatgcgatcggcagag
ccgtctgtgttcactagaactacagctgagggcgtggctcgtgtccgcaagtccaagggc
aaatttgcctttctcctggagtccacgatgaatgaatacattgagcagcgaaagccctgt
gacacgatgaaagtgggaggaaacctggattccaaaggctatggtgtagcaacgcccaag
ggttcctcattaagaaatgctgttaacctcgcagttttaaaactgaatgaacaaggcctc
ttggacaaattgaaaaacaaatggtggtacgacaaaggagaatgtggcagcgggggaggt
gactccaaggacaagacgagtgccttgagcctgagcaacgtagcaggcgtcttctacatt
ctggttggcggcctgggcttggcaatgctggtggctttgatagagttctgttacaagtcc
agggcagaggcgaagagaatgaagctgactttttccgaagccataagaaacaaagccagg
ttatccatcactgggagtgtgggagaaaacggccgtgtgctgacccctgactgccccaag
gccgtacacacaggaactgcaattagacaaagttcgggattggctgtcattgcatcggac
ctaccataa

DBGET integrated database retrieval system