KEGG   Rattus norvegicus (rat): 29644Help
Entry
29644             CDS       T01003                                 

Gene name
Ptpn5, STEP
Definition
protein tyrosine phosphatase, non-receptor type 5 (EC:3.1.3.48)
Orthology
K18018  
tyrosine-protein phosphatase non-receptor type 5 [EC:3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:rno04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
1q22
AA seq 369 aa AA seqDB search
MEEKVEDDFLDLDAVPETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTP
GCNEEGFGYLVSPREESAHEYLLSASRVLRAEELHEKALDPFLLQAEFFEIPMNFVDPKE
YDIPGLVRKNRYKTILPNPHSRVRLTSPDPEDPLSSYINANYIRGYNGEEKVYIATQGPI
VSTVVDFWRMVWQERTPIIVMITNIEEMNEKCTEYWPEEQVVHDGVEITVQKVIHTEDYR
LRLISLRRGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCSPIIVHC
SAGIGRTGCFIATSICCQQLRREGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHAMSLYE
KQLSLQSSE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaaggtagaggatgactttctggacctggacgcagtgccggagacacccgtg
tttgactgtgtgatggacatcaagcctgaggctgatcccacctcgttgactgtcaagtcc
atgggtctgcaggagaggaggggctccaatgtctccttgaccctggacatgtgtactcct
ggctgcaatgaggagggctttggctacctggtgtccccacgagaggagtcagcccatgaa
tacctgctcagtgcctcccgtgtcctccgggcagaggagctgcacgaaaaggccctggac
cctttcttgctgcaggcggaattctttgaaatccccatgaactttgtggatccaaaagaa
tatgacatcccagggctggtacggaagaatcggtacaaaaccatccttcccaatcctcac
agcagggtacgtctgacgtcaccagaccctgaagatcctctgagttcctacatcaatgcc
aactatatccggggctacaatggggaggagaaggtgtacatcgccacccagggacccatc
gtcagcactgtggtcgacttctggcgcatggtgtggcaggagcgcacacccatcatcgtc
atgatcaccaacatcgaggagatgaacgagaagtgcacggaatattggccagaagagcag
gtcgtccacgatggcgtagagatcactgtgcagaaagtcatccacacagaggactaccgg
ctgcgacttatctccctcaggagagggactgaagagagaggcttgaagcattactggttc
acatcctggcctgaccagaagacccccgaccgggcacccccactcctgcacctggtacgg
gaggtggaggaggcagcccagcaagagggaccccactgttccccgatcattgttcactgc
agtgcagggattgggagaaccgggtgcttcatcgccaccagcatctgctgccagcagctg
cgacgtgagggcgtggtagacatcctaaagaccacgtgccagctccgtcaggacaggggc
ggcatgatccaaacatgcgaacagtatcagtttgtgcaccacgccatgagcctctatgag
aagcagctatccctccagtcctcagagtga

DBGET integrated database retrieval system