KEGG   Rattus norvegicus (rat): 29650Help
Entry
29650             CDS       T01003                                 

Gene name
Adam10, MADM
Definition
(RefSeq) ADAM metallopeptidase domain 10 (EC:3.4.24.81)
  KO
K06704  
disintegrin and metalloproteinase domain-containing protein 10 [EC:3.4.24.81]
Organism
rno  Rattus norvegicus (rat)
Pathway
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    29650 (Adam10)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.81  ADAM10 endopeptidase
     29650 (Adam10)
Peptidases [BR:rno01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   29650 (Adam10)
Cellular antigens [BR:rno04090]
 Proteins
  29650 (Adam10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8q24
AA seq 749 aa AA seqDB search
MVLPTVLILLLSWAAGLGGQYGNPLNKYIRHYEGLSYNVDSLHQKHQRAKRAVSHEDQFL
LLDFHAHGRQFNLRMKRDTSLFSDEFKVETSNKVLDYDTSHIYTGHIYGEEGSFSHGSVV
DGRFEGFIQTRGGTFYIEPAERYIKDRILPFHSVIYHEDDINYPHKYGPQGGCADHSVFE
RMRKYQMTGVEEGTRAHSEEHAASMGPELLRKKRTTLAERNTCQLYIQTDHLFFKYYGTR
EAVIAQISSHVKAIDTIYQTTDFSGIRNISFMVKRIRINTTSDEKDPTNPFRFPNIGVEK
FLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLN
TGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYA
RATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQC
KDECCFDANQPEGKKCKLKPGKQCSPSQGPCCTAQCAFKSKSEKCRDDSDCAKEGICNGF
TALCPASDPKPNFTDCNRHTQVCINGQCAGSICEKYDLEECTCASSDGKDDKELCHVCCM
KKMAPSTCASTGSLQWNKQFNGRTITLQPGSPCNDFRGYCDVFMRCRLVDADGPLARLKK
AIFSPQLYENIAEWIVAHWWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGT
LKRRRPPQPIQQPPRQRPRESYQMGHMRR
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggtgttgccgacagtgttaattctgctcctctcctgggcggcggggctgggaggtcag
tatggaaatcctttaaataaatatattagacattatgaaggattatcttacaatgtggat
tcattacaccaaaaacaccagcgtgccaaacgagcagtctcacacgaggaccagttttta
cttctagatttccatgctcatggaagacaattcaacctacgaatgaagagggacacttcc
ctttttagtgatgaatttaaagtagaaacgtcaaataaagtacttgattatgatacctct
catatttacactggacatatttatggtgaagaaggaagctttagtcatgggtctgtcgtt
gatggaagatttgaaggtttcatccagactcggggtggcacattttatattgagccagca
gagagatatattaaagaccgaatcctgccgtttcactctgtcatttatcatgaagatgat
attaactatccccataaatacggcccacaggggggctgtgcagatcactccgtctttgaa
aggatgaggaaataccaaatgactggagtagaggaaggaactcgggcacattcagaggag
catgctgctagtatgggtcctgagctcctgaggaaaaagcgcacaactctggctgagaga
aatacttgtcagctctatatccagacagatcacctgttctttaaatactatggaacacga
gaagctgtgattgctcagatatccagtcatgttaaagcaattgatacaatttaccagact
acagacttctccggaatccgtaacatcagctttatggtgaaacgcataagaatcaataca
acatctgatgaaaaagatcctacaaatcctttccgtttcccaaatattggtgtggagaag
ttcctggagttgaattctgagcagaatcatgatgactactgcttggcctatgtcttcacg
gaccgggattttgatgatggtgttcttggtctggcatgggttggagcaccttcaggaagc
tctggaggaatatgtgagaaaagcaagttgtattcagatggcaagaagaagtcattgaac
acgggcatcattactgttcagaactatggctctcacgtgcctcccaaagtctctcatatt
acttttgctcatgaagttggacataactttggatctccacatgattctggaacagagtgc
actccaggagagtctaagaacttaggacaaaaagaaaatggcaattacatcatgtatgcg
agagcaacgtctggggacaaacttaacaacaacaaattttcactctgcagcattaggaac
ataagccaagtgcttgagaagaagaggaacaactgttttgttgaatctggccagcctatc
tgtggaaatgggatggtggagcaaggggaagagtgtgactgtggctacagtgaccaatgc
aaagatgagtgctgcttcgatgcaaaccagccagaggggaagaaatgcaagctgaagcct
gggaagcagtgcagtccaagtcaaggaccctgctgtacagcacagtgtgcattcaagtca
aagtctgagaaatgtcgggatgattctgactgtgcaaaggaagggatatgcaatggcttc
acagccctttgcccagcatctgatcccaagcccaactttacagactgtaacaggcataca
caagtgtgcattaatgggcaatgtgcaggttctatctgtgagaagtatgacttggaggag
tgcacctgtgccagctctgatggcaaagatgataaggaattatgtcatgtttgctgcatg
aagaaaatggccccatcaacttgtgccagtacaggctctttgcagtggaacaagcagttc
aatggtcggactatcactctgcagccaggctctccatgtaatgacttcagaggctactgt
gatgttttcatgcggtgcagattagtagatgctgatggccctctagctaggctgaaaaaa
gcaatttttagtccacaactctatgaaaacattgctgagtggattgtggctcactggtgg
gcagtactgcttatgggaattgccctgatcatgctaatggctggatttatcaagatttgc
agtgttcacactccaagtagtaatccaaagttgcctcctcctaaaccacttccaggcact
ttaaagaggaggagaccgccacagcccattcagcagcccccgcgtcagaggccccgggag
agttatcaaatgggacacatgcgacgctga

DBGET integrated database retrieval system