KEGG   Rattus norvegicus (rat): 296501Help
Entry
296501            CDS       T01003                                 

Gene name
Hat1
Definition
histone acetyltransferase 1 (EC:2.3.1.48)
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Substance dependence
   05034 Alcoholism
    296501 (Hat1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     296501 (Hat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q21
AA seq 419 aa AA seqDB search
MAGFGAMEKFLVEYKSAVEKKLAEYKCNTNTAIELKLVRFPEDLENDIRTFFPEYTHQLF
GDDETAFGYKGLKILLYYIAGSLSTMFRVEYASKVDENFDCVEADDVEGKIRQIIPPGFC
TNTNDFLSLLEKEADFKPFGTLLHTYSVPSPTGGENFTFQIYKADMTCRGFREYHERLQT
FLMWFIETASFIDVDDERWHYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQ
MLILTPFQGQGHGAQLLETVHRYYIASSSVLDITAEDPSKSYVKLRDFVLVKLCQDLPCF
SRERLLQGFNEDMAIQAQQKFKINKQHARRVYEILRLLVTDMSDAEQCRSYRLDIKRRLI
SPYKKKQTDLAKMRKCLRPEELTNQMNQIEISVQHEQLEEQFQELVEDYRRVIERLAQE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcggggtttggtgcaatggagaaatttctagtggaatataagagtgcggtggagaag
aaactggctgagtacaagtgtaacaccaacacagcaatcgagctgaaactggttcgtttt
cctgaagatcttgagaatgacattagaactttctttcctgaatatacccatcaactcttt
ggggatgatgaaactgcttttggttacaagggcctgaagatcttgttgtactatattgct
ggtagcctgtcaactatgttccgtgttgaatatgcatctaaagttgatgagaactttgat
tgtgtggaggcagatgacgttgaaggcaaaatcagacaaatcattccacctgggttttgc
acaaacacaaatgattttctttccttgctggaaaaggaagctgatttcaagccatttgga
accctcctccatacatactcagttcctagtccaacaggaggagaaaactttacttttcag
atatacaaggctgacatgacatgtagaggctttcgagaatatcatgaaaggcttcagacc
tttttgatgtggtttattgaaactgctagctttattgacgtggatgatgaaagatggcac
tactttctagtatttgagaagtataataaggatggagctacgctctttgcgaccgtaggc
tacatgacagtctataattactatgtgtacccagacaaaacccggccacgtgtaagtcag
atgctgatactgactccatttcaaggtcagggccatggtgctcaacttcttgaaacagtt
catagatactacattgcatcttcttcagttcttgatattacagcggaagatccatccaaa
agctatgtgaaactaagagactttgtacttgtgaaactttgtcaagatttgccctgtttc
tcccgggaaagattactgcaaggattcaatgaagatatggcgatacaggcacagcagaag
ttcaaaataaataagcaacatgctagacgggtttatgaaattctccgactgctggtgact
gacatgagtgacgcggagcagtgcagaagctacagactggatattaaaaggagactaatc
agcccttacaagaaaaagcagacagatcttgccaagatgaggaaatgcctgagaccagaa
gagctgacgaatcagatgaaccagatagagataagtgtgcagcacgagcagctggaggag
cagtttcaggagctggtggaggactaccggcgtgtcattgagcgccttgctcaagagtga

DBGET integrated database retrieval system