KEGG   Rattus norvegicus (rat): 296504Help
Entry
296504            CDS       T01003                                 

Gene name
Abo2, Abo, NAGAT_2
Definition
histo-blood group ABO system transferase 2
Orthology
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - lacto and neolacto series [PATH:rno00601]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
3p12
AA seq 334 aa AA seqDB search
MKDLRLGRLKCYSLHLGILPLTVLVLVFFCFVCLSLRSQEWGHPGAVNRKAYPQPRVLTP
TRTDVLVLTPWLAPIIWEGTFNIDILNEQFRLRNTTIGLTVFAIKKYVVFLKLFLETAEQ
HFMVGHKVIYYVFTDRPADVPQVPLGAGRRLVVLAVRNYTRWQDVSMHRMEIISHFSEQR
FWHEVDYLVCGDVDMKFRDHVGVEILSALFGTLHPGFYRSRRESFTYERRPQSQAYIPWD
QGDFYYMGAFFGGSVVEVHHLTKACHQAMVEDQDNGIEAVWHDESHLNKYLLYHKPTKVL
SPEYMWDQQLLGWPSIMKKLRYVAVPKNHQAIRN
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatctgcggttgggaagactgaaatgctactcccttcatcttggaatccttccc
ctcacggtgctcgtcttagtcttcttttgcttcgtgtgcctgagtctcagaagccaggaa
tgggggcacccaggagctgtgaataggaaggcctatccccagccaagggtactgacaccc
actaggacagatgttcttgtcctgactccttggctggctcccatcatctgggaggggacc
ttcaacattgacatactgaatgagcagttcaggcttcggaacaccacaatcggactaact
gtgtttgccatcaaaaagtatgtggtgttcctgaagctcttcctggagacggcagagcag
cacttcatggtgggacataaggtcatctactatgtcttcactgaccggccagctgatgtc
ccacaggtgcccctgggtgcaggacggcggctggtggtgctagctgtgcgcaactacacc
cgctggcaggacgtgtccatgcacaggatggagataatcagccacttctcagagcagcgc
ttttggcatgaggtggactacctggtgtgtggagatgtggacatgaagttcagggaccac
gtgggtgtggagattctctcagcgctctttggcaccctgcatcctggcttttaccgtagc
cgacgagagtcctttacctatgagcgccggccacagtcccaggcctacatcccctgggac
cagggtgacttttactatatgggagccttctttggggggtcagtggtggaggtgcaccat
ctcaccaaggcctgccaccaggctatggtggaggaccaggacaatggcattgaggccgtg
tggcatgacgagagccatctgaacaagtacctgctataccataagccgacaaaggtgctg
tccccagagtacatgtgggaccagcagctgctgggctggccctccatcatgaagaagctg
agatatgtggccgtgcccaagaaccatcaggcgatcaggaactga

DBGET integrated database retrieval system