KEGG   Rattus norvegicus (rat): 29682Help
Entry
29682             CDS       T01003                                 

Gene name
Kcnq3
Definition
(RefSeq) potassium voltage-gated channel subfamily Q member 3
  KO
K04928  
potassium voltage-gated channel KQT-like subfamily member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    29682 (Kcnq3)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  K+ channel, KCNQ, Kv7.x (KQT-like)
   29682 (Kcnq3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
7q33
AA seq 912 aa AA seqDB search
MALEFPGLQPPPPPRPVPQALLLPGAAAEKAKRPVGARQMGLKARRAAGAAGGGGGEGGG
GGGGAANPAGGDSAVAGDEERKVGLAPGDVEQVTLALGTGADKDGTLLLEGGGREEGQRR
TPQGIGLLAKTPLSRPVKRNNAKYRRIQTLIYDALERPRGWALLYHALVFLIVLGCLILA
VLTTFKEYETVSGDWLLLLETFAIFIFGAEFALRIWAAGCCCRYKGWRGRLKFARKPLCM
LDIFVLIASVPVVAVGNQGNVLATSLRSLRFLQILRMLRMDRRGGTWKLLGSAICAHSKE
LITAWYIGFLTLILSSFLVYLVEKDVPEMDAQGEEMKEEFETYADALWWGLITLATIGYG
DKTPKTWEGRLIAATFSLIGVSFFALPAGILGSGLALKVQEQHRQKHFEKRRKPAAELIQ
AAWRYYATNPNRLDLVATWRFYESVVSFPFFRKEQLEAAASQKLGLLDRVRLSNPRGSNT
KGKLFTPLNVDAIEESPSKEPKPVGLNNKERFRTAFRMKAYAFWQSSEDAGTGDPMTEDR
GYGNDFLIEDMIPTLKAAIRAVRILQFRLYKKKFKETLRPYDVKDVIEQYSAGHLDMLSR
IKYLQTRIDMIFTPGPPSTPKHKKSQKGSAFTYPSQQSPRNEPYVARAATSETEDQSMMG
KFVKVERQVHDMGKKLDFLVDMHMQHMERLQVHVTEYYPTKGASSPAEGEKKEDNRYSDL
KTIICNYSESGPPDPPYSFHQVPIDRVGPYGFFAHDPVKLTRGGPSSTKAQANLPSSGST
YAERPTVLPILTLLDSCVSYHSQTELQGPYSDHISPRQRRSITRDSDTPLSLMSVNHEEL
ERSPSGFSISQDRDDYVFGPSGGSSWMREKRYLAEGETDTDTDPFTPSGSMPMSSTGDGI
SDSIWTPSNKPT
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atggcattggagttcccgggcttgcagccgccgccgccgcctcgtcccgtaccccaagcg
ctccttcttcccggagcagcagcggagaaggcgaagcgcccggtgggggcgaggcagatg
gggctcaaggctcgcagggcggcgggggcggccggcgggggcggcggcgaagggggcgga
ggaggcggcggggcggctaacccggctggaggggactcggcagtggccggcgacgaggag
cggaaagtggggctggcgccaggagacgtggagcaagtcaccttggcgctagggaccgga
gccgacaaagacgggaccctgctgctggagggcggtggccgcgaagaggggcagaggagg
accccgcagggcatcgggctcctggcaaagacccccctgagccgtccagttaagaggaac
aacgccaagtacaggcgcatccaaactttgatctatgacgccctggagagaccgaggggc
tgggcgctgctctaccacgcgcttgtgttcctgattgtcctgggatgcttgattctggcc
gtgctcaccactttcaaggagtatgagactgtgtctggagactggcttttgctgctggaa
acatttgctattttcatctttggagctgagtttgctttgaggatctgggctgcaggatgt
tgctgtcgatacaaaggctggcgtggacggctgaagtttgccaggaagcccctgtgcatg
ttggatatcttcgtgctgattgcttctgtgccagtggttgccgtgggaaaccagggcaat
gtcctggctacctctctgcgaagcctccgcttcctgcagatcctgcgcatgcttcgaatg
gataggaggggtggcacctggaagctcctgggctcagctatctgtgcccacagcaaagaa
ctcatcaccgcctggtacatcggcttcctgacactcatcctttcttcatttcttgtctac
ctggtggagaaggatgtgccagagatggatgcccaaggagaggaaatgaaagaggagttt
gagacctatgctgatgccctgtggtggggcctgatcacactggccaccattggttatgga
gacaagacacctaaaacctgggaaggacgtctgattgctgccaccttttctttaatcggc
gtctccttttttgctcttccggcaggcatccttggctcaggactggcattgaaggttcag
gaacagcaccgtcagaagcactttgagaagagaaggaagccagctgctgaactcatccag
gctgcctggagatattatgctaccaaccccaacaggcttgacctggtggcaacctggaga
ttttatgaatcagttgtctctttcccattcttcaggaaagaacaactggaagcagcagcc
agccaaaagctgggtctcttggatcgggttcgcctttctaatcctcgtggtagcaatact
aaaggaaagctatttacccctctgaatgtagatgccatagaagaaagcccttccaaagag
ccaaagcccgttggcttaaacaataaagagcgtttccgcaccgccttccgcatgaaagcc
tacgctttctggcagagttctgaagatgccgggacaggagaccccatgacagaagacagg
ggctatggaaatgacttcctcattgaagacatgatccccaccctaaaggctgccatccga
gctgtcagaattctacaattccgtctgtataaaaaaaaattcaaggagacattgaggcct
tatgatgtaaaagatgtaattgagcagtattctgctggacatcttgacatgctttccagg
ataaagtaccttcagacaagaatagatatgattttcacccctggacctccatccactcca
aaacataagaagtctcagaaagggtcagcatttacctacccatcccagcagtctccaagg
aatgaaccatatgtagccagggcagccacatcagaaactgaagaccaaagcatgatgggg
aagtttgtaaaagttgaaagacaggttcacgacatggggaagaaactggacttcctcgtg
gacatgcacatgcagcatatggagcgtctgcaggtgcacgtcaccgagtactacccaaca
aagggggcctcctccccagcagaaggggagaagaaagaggacaacaggtattctgacttg
aaaaccatcatctgtaactactcagaatcaggcccccccgacccaccctacagcttccac
caggtgcccatcgacagagttggcccctatgggttttttgcacatgaccccgtgaaactg
accagagggggacccagttctacaaaggctcaggccaaccttccctcctcgggaagtaca
tatgcagagaggcccacagtcctgcccatcttgactcttctggactcatgtgtgagctac
cactcccagacagaactgcaaggcccctattcggaccacatctcaccccgccagagacgc
agcatcactagggacagtgacacaccactgtccctcatgtccgtcaaccacgaggaactg
gaacggtctccaagtggcttcagcatctcccaagacagagatgattatgtatttggcccc
agtgggggttcgagctggatgagggaaaagcggtacctggctgaaggagaaacagacaca
gatacagaccccttcacgcccagtggatccatgcctatgtcatctactggagatggtatt
tcagattccatatggaccccttccaacaagcccacttag

DBGET integrated database retrieval system