KEGG   Rattus norvegicus (rat): 29702Help
Entry
29702             CDS       T01003                                 

Gene name
Eif2ak3, PEK
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 3
  KO
K08860  
eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Mitophagy - animal
Autophagy - animal
Protein processing in endoplasmic reticulum
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Hepatitis C
Measles
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    29702 (Eif2ak3)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    29702 (Eif2ak3)
   04137 Mitophagy - animal
    29702 (Eif2ak3)
  Cell growth and death
   04210 Apoptosis
    29702 (Eif2ak3)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    29702 (Eif2ak3)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    29702 (Eif2ak3)
  Infectious diseases
   05162 Measles
    29702 (Eif2ak3)
   05164 Influenza A
    29702 (Eif2ak3)
   05160 Hepatitis C
    29702 (Eif2ak3)
   05168 Herpes simplex infection
    29702 (Eif2ak3)
   05169 Epstein-Barr virus infection
    29702 (Eif2ak3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     29702 (Eif2ak3)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: Other group
  PEK family [OT]
   29702 (Eif2ak3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
UniProt: 
Position
4q31
AA seq 1108 aa AA seqDB search
MERATQPRPRALLLLFLLLGCAAGISAVARARSLLAPTSDTAFGLGAAAAPTSAARVPAV
ATAEVTVEDAEALPAASGEQESRATESDDDVELRPRGRSLVIISTLDGRIAALDAENHGK
KQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGDLFQWDRDRESMEAVPFTVESLLESS
YKFGDDVVLVGGKSLTTYGLSAYSGKLRYICSALGCRRWDSDEMEEEEDILLLQRTQKTV
RAVGPRSGSEKWNFSVGHFELRYIPDMETRAGFIESTFKLGGNKEDSKIISDVEEQDVDT
VIKVSVADWKVMAFSKKGGRLEWEYQFCTPIASAWLVRDGKVIPISLFDDTSYTANEEVL
EDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRVSEKFPTRPKALESVNGESAIIPLPT
IKWKPLIHSPSRTPVLVGSDEFDKCLSNDKYSHEEYSNGALSILQYPYDNGYYLPYYKRE
RNKRSTQITVRFLDSPHYSKNIRKKDPILLLHWWKEIFGTILLCIVATTFIVRRLFHPQP
HRQRKESETQCQTESKYDSVSADNSDNSWNDIKHSGYVSRYLTDFEPIQCMGRGGFGVVF
EAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLETPPEKWQE
EMDEIWLKDESTDWPLSSPSPMDAPSVKIRQMDPFSTKEQIEVIAPSPERSRSFSVGISC
GRTSSSESQFSPLEFSGTDCGDNSDSEDAAHNLQDSCLTDCDMEDGTVDGDDEGHSFELC
PSEASPYTRSREGTSSSIVFEDSGCDNASSKEDPRMNRLHNGHHYVNKLTEFKHSSSRSS
SEATLSTSPTRPTTLSLDFTRNTVDRLQPSSPKVYLYIQMQLCRKENLKDWMNRRCSMED
REHRVCLHIFLQIAEAVQFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVTAMDQDEEE
QTVLTPMPAYATHTGQVGTKLYMSPEQIHGNNYSHKVDIFSLGLILFELLYPFSTQMERV
RTLTDVRNLKFPPLFTQKYPQEHMMVQDMLSPSPMERPEATDIIENAVFENLEFPGKTVL
RQRSRSLSSSGTKHSRQPSSTFSPLPGN
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgccacccagccccgaccgcgcgcgctgctgctgctgttcctgctgctgggc
tgcgcggcggggatctcagcggtcgcgcgcgcccgcagcttgcttgctcccacatcggat
acggcatttggcttgggggcagcagccgcccctacttcagccgcgcgggtgcctgcggtg
gctacggccgaagtgaccgtggaagacgccgaggcattgcccgctgcctccggcgaacag
gagtcacgcgcgaccgagtccgatgacgacgtggaactgcggcctcgcggcaggtcctta
gtaatcatcagcactttagatggacgaattgccgcactggatgccgagaatcatgggaaa
aagcagtgggatttggacgtgggatctggttccttggtttcatctagccttagcaagcca
gaggtgtttgggaacaagatgatcattccttccctggacggagacctcttccagtgggac
cgagaccgagagagcatggaggccgtccctttcactgtggagtcccttctcgaatcttca
tacaagtttggagatgatgttgttctggttggaggaaagtctctgaccacatacgggctc
agtgcatatagtggaaagctgaggtatatctgttctgccttgggatgtcgccgatgggat
agtgatgaaatggaagaagaggaagacatcttgcttctgcaacgcacgcagaagactgtg
cgagctgtcgggcctcgaagcggcagtgagaagtggaatttcagtgttggccactttgaa
cttcggtatattccagacatggaaactagagccggattcattgaaagcacctttaaactg
ggtggaaacaaagaagactctaaaatcatttcagatgtggaagaacaagatgtggacaca
gtgataaaagtttccgttgctgattggaaggtcatggcgtttagtaagaagggaggccgc
ctagaatgggagtaccagttttgtactcccattgcgtctgcctggctggtgagggatggt
aaagtcatccccatcagtctgtttgatgacacaagttacacagccaatgaggaagttttg
gaagatgaagaagacattgtagaggctgctcggggagccacagagaacagcgtgtactta
gggatgtacagaggccagctgtacctgcaatcatccgtcagggtctcggaaaagttccct
acaaggccgaaggccttggagtctgtaaatggagaaagtgccattattcctctgccgacg
atcaaatggaagcccttaatccattctccgtctaggactcctgtcttggttgggtctgat
gaatttgacaagtgtctaagtaatgataaatattcccatgaagaatacagtaatggtgcg
ctttcaatcctacagtatccatatgacaacggttactatctgccttattacaagagagaa
aggaataagcggagcacgcagatcacggtcaggttcctggacagcccgcactacagcaag
aacatccgcaagaaggaccccatcctcctcctgcactggtggaaggaaatatttggaacg
atcttgctttgcattgtggccacgacctttatcgtgcgcaggcttttccatcctcagccc
cacaggcaacggaaggagtctgaaactcagtgccaaactgaaagtaaatacgactctgtg
agtgctgataacagcgacaacagctggaacgacattaaacactcaggatacgtgtcccga
tacctaacagattttgagccaattcagtgcatgggtcgaggcggctttggcgttgtcttt
gaagctaagaacaaagtagatgactgcaattacgccatcaagaggatccgtctcccaaac
agggagctggcacgggagaaggtaatgcgggaagtcaaagccttggctaagctggagcac
ccaggcatcgtgaggtatttcaatgcgtggctggaaacaccaccagagaagtggcaagag
gagatggatgaaatctggctgaaggacgaaagcacagactggccactcagctcccctagc
ccaatggatgccccatctgttaagatccggcagatggatcctttctctacaaaagaacag
attgaagtcatagctccttctcctgaaagaagtcggtctttctcagtgggcatttcctgt
ggccggacaagctcatctgagagccagttctctcccctggagttctcagggacagactgt
ggagacaacagtgactcagaggacgcagcccacaacctccaggacagctgcctgacagat
tgcgacatggaagatggtacagtggacggcgatgatgagggacactcctttgaactttgt
ccttctgaagcttctccctataccaggtcaagggagggaacgtcctcttccatagtgttt
gaagactctggctgtgataatgcgtccagtaaggaggaccccagaatgaatcggctgcat
aatggccaccattacgttaataagctaactgagttcaagcactccagcagcaggtcttct
tccgaagccaccttgtctacctctcctaccaggccaaccaccctaagtttagatttcacc
aggaacacggtggaccggctccagcccagctcccccaaggtgtacctgtacatccagatg
cagctgtgcaggaaggagaaccttaaagactggatgaaccggcgctgcagcatggaggac
agggagcacagagtgtgcctgcacatctttctgcagatcgcagaggcagtgcagtttctg
cacagcaagggactcatgcacagggacctcaagccttccaacatattcttcacaatggat
gatgtggtcaaagttggggactttgggctagtgactgcaatggaccaggatgaagaagag
cagacagtactgactccaatgccagcctatgctacacacacgggacaagtcgggaccaag
ctgtacatgagcccagaacagattcatggaaacaactactcccataaagtggacatcttc
tctttaggcttgattctgtttgaactcctttacccattcagcactcagatggaacgagtt
aggactttaactgatgtaagaaatctcaagtttccaccactgttcactcagaaatatccc
caagagcatatgatggttcaagacatgctttctccatcccccatggagcggcctgaagcc
acagacatcattgaaaatgctgtgtttgagaacttggagtttcctgggaaaacggttctg
agacagcggtcccgctccttgagttcatccggaactaaacattccagacagcccagcagc
acattcagcccactgcctggcaactag

DBGET integrated database retrieval system