KEGG   Rattus norvegicus (rat): 29702Help
Entry
29702             CDS       T01003                                 

Gene name
Eif2ak3, PEK
Definition
(RefSeq) eukaryotic translation initiation factor 2 alpha kinase 3 (EC:2.7.11.1)
  KO
K08860  
eukaryotic translation initiation factor 2-alpha kinase 3 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Hepatitis C
Measles
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    29702 (Eif2ak3)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    29702 (Eif2ak3)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    29702 (Eif2ak3)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    29702 (Eif2ak3)
  Infectious diseases
   05162 Measles
    29702 (Eif2ak3)
   05164 Influenza A
    29702 (Eif2ak3)
   05160 Hepatitis C
    29702 (Eif2ak3)
   05168 Herpes simplex infection
    29702 (Eif2ak3)
   05169 Epstein-Barr virus infection
    29702 (Eif2ak3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     29702 (Eif2ak3)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: Other group
  PEK family [OT]
   29702 (Eif2ak3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q32
AA seq 1108 aa AA seqDB search
MERATQPRPRALLLLFLLLGCAAGISAVARARSLLAPTSDTAFGLGAAAAPTSAARVPAV
ATAEVTVEDAEALPAASGEQESRATESDDDVELRPRGRSLVIISTLDGRIAALDAENHGK
KQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGDLFQWDRDRESMEAVPFTVESLLESS
YKFGDDVVLVGGKSLTTYGLSAYSGKLRYICSALGCRRWDSDEMEEEEDILLLQRTQKTV
RAVGPRSGSEKWNFSVGHFELRYIPDMETRAGFIESTFKLGGNKEDSKIISDVEEQDVDT
VIKVSVADWKVMAFSKKGGRLEWEYQFCTPIASAWLVRDGKVIPISLFDDTSYTANEEVL
EDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRVSEKFPTRPKALESVNGESAIIPLPT
IKWKPLIHSPSRTPVLVGSDEFDKCLSNDKYSHEEYSNGALSILQYPYDNGYYLPYYKRE
RNKRSTQITVRFLDSPHYSKNIRKKDPILLLHWWKEIFGTILLCIVATTFIVRRLFHPQP
HRQRKESETQCQTESKYDSVSADNSDNSWNDIKHSGYVSRYLTDFEPIQCMGRGGFGVVF
EAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLETPPEKWQE
EMDEIWLKDESTDWPLSSPSPMDAPSVKIRQMDPFSTKEQIEVIAPSPERSRSFSVGISC
GRTSSSESQFSPLEFSGTDCGDNSDSEDAAHNLQDSCLTDCDMEDGTVDGDDEGHSFELC
PSEASPYTRSREGTSSSIVFEDSGCDNASSKEDPRMNRLHNGHHYVNKLTEFKHSSSRSS
SEATLSTSPTRPTTLSLDFTRNTVDRLQPSSPKVYLYIQMQLCRKENLKDWMNRRCSMED
REHRVCLHIFLQIAEAVQFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVTAMDQDEEE
QTVLTPMPAYATHTGQVGTKLYMSPEQIHGNNYSHKVDIFSLGLILFELLYPFSTQMERV
RTLTDVRNLKFPPLFTQKYPQEHMMVQDMLSPSPMERPEATDIIENAVFENLEFPGKTVL
RQRSRSLSSSGTKHSRQPSSTFSPLPGN
NT seq 3327 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgccacccagccccgaccgcgcgcgctgctgctgctgttcctgctgctgggc
tgcgcggcggggatctcagcggtcgcgcgcgcccgcagcttgcttgctcccacatcggat
acggcatttggcttgggggcagcagccgcccctacttcagccgcgcgggtgcctgcggtg
gctacggccgaagtgaccgtggaagacgccgaggcattgcccgctgcctccggcgaacag
gagtcacgcgcgaccgagtccgatgacgacgtggaactgcggcctcgcggcaggtcctta
gtaatcatcagcactttagatggacgaattgccgcactggatgccgagaatcatgggaaa
aagcagtgggatttggacgtgggatctggttccttggtttcatctagccttagcaagcca
gaggtgtttgggaacaagatgatcattccttccctggacggagacctcttccagtgggac
cgagaccgagagagcatggaggccgtccctttcactgtggagtcccttctcgaatcttca
tacaagtttggagatgatgttgttctggttggaggaaagtctctgaccacatacgggctc
agtgcatatagtggaaagctgaggtatatctgttctgccttgggatgtcgccgatgggat
agtgatgaaatggaagaagaggaagacatcttgcttctgcaacgcacgcagaagactgtg
cgagctgtcgggcctcgaagcggcagtgagaagtggaatttcagtgttggccactttgaa
cttcggtatattccagacatggaaactagagccggattcattgaaagcacctttaaactg
ggtggaaacaaagaagactctaaaatcatttcagatgtggaagaacaagatgtggacaca
gtgataaaagtttccgttgctgattggaaggtcatggcgtttagtaagaagggaggccgc
ctagaatgggagtaccagttttgtactcccattgcgtctgcctggctggtgagggatggt
aaagtcatccccatcagtctgtttgatgacacaagttacacagccaatgaggaagttttg
gaagatgaagaagacattgtagaggctgctcggggagccacagagaacagcgtgtactta
gggatgtacagaggccagctgtacctgcaatcatccgtcagggtctcggaaaagttccct
acaaggccgaaggccttggagtctgtaaatggagaaagtgccattattcctctgccgacg
atcaaatggaagcccttaatccattctccgtctaggactcctgtcttggttgggtctgat
gaatttgacaagtgtctaagtaatgataaatattcccatgaagaatacagtaatggtgcg
ctttcaatcctacagtatccatatgacaacggttactatctgccttattacaagagagaa
aggaataagcggagcacgcagatcacggtcaggttcctggacagcccgcactacagcaag
aacatccgcaagaaggaccccatcctcctcctgcactggtggaaggaaatatttggaacg
atcttgctttgcattgtggccacgacctttatcgtgcgcaggcttttccatcctcagccc
cacaggcaacggaaggagtctgaaactcagtgccaaactgaaagtaaatacgactctgtg
agtgctgataacagcgacaacagctggaacgacattaaacactcaggatacgtgtcccga
tacctaacagattttgagccaattcagtgcatgggtcgaggcggctttggcgttgtcttt
gaagctaagaacaaagtagatgactgcaattacgccatcaagaggatccgtctcccaaac
agggagctggcacgggagaaggtaatgcgggaagtcaaagccttggctaagctggagcac
ccaggcatcgtgaggtatttcaatgcgtggctggaaacaccaccagagaagtggcaagag
gagatggatgaaatctggctgaaggacgaaagcacagactggccactcagctcccctagc
ccaatggatgccccatctgttaagatccggcagatggatcctttctctacaaaagaacag
attgaagtcatagctccttctcctgaaagaagtcggtctttctcagtgggcatttcctgt
ggccggacaagctcatctgagagccagttctctcccctggagttctcagggacagactgt
ggagacaacagtgactcagaggacgcagcccacaacctccaggacagctgcctgacagat
tgcgacatggaagatggtacagtggacggcgatgatgagggacactcctttgaactttgt
ccttctgaagcttctccctataccaggtcaagggagggaacgtcctcttccatagtgttt
gaagactctggctgtgataatgcgtccagtaaggaggaccccagaatgaatcggctgcat
aatggccaccattacgttaataagctaactgagttcaagcactccagcagcaggtcttct
tccgaagccaccttgtctacctctcctaccaggccaaccaccctaagtttagatttcacc
aggaacacggtggaccggctccagcccagctcccccaaggtgtacctgtacatccagatg
cagctgtgcaggaaggagaaccttaaagactggatgaaccggcgctgcagcatggaggac
agggagcacagagtgtgcctgcacatctttctgcagatcgcagaggcagtgcagtttctg
cacagcaagggactcatgcacagggacctcaagccttccaacatattcttcacaatggat
gatgtggtcaaagttggggactttgggctagtgactgcaatggaccaggatgaagaagag
cagacagtactgactccaatgccagcctatgctacacacacgggacaagtcgggaccaag
ctgtacatgagcccagaacagattcatggaaacaactactcccataaagtggacatcttc
tctttaggcttgattctgtttgaactcctttacccattcagcactcagatggaacgagtt
aggactttaactgatgtaagaaatctcaagtttccaccactgttcactcagaaatatccc
caagagcatatgatggttcaagacatgctttctccatcccccatggagcggcctgaagcc
acagacatcattgaaaatgctgtgtttgagaacttggagtttcctgggaaaacggttctg
agacagcggtcccgctccttgagttcatccggaactaaacattccagacagcccagcagc
acattcagcccactgcctggcaactag

DBGET integrated database retrieval system