KEGG   Rattus norvegicus (rat): 29737Help
Entry
29737             CDS       T01003                                 

Gene name
Kcnab1, KvBeta3
Definition
(RefSeq) potassium voltage-gated channel subfamily A member regulatory beta subunit 1
  KO
K04882  
potassium voltage-gated channel Shaker-related subfamily A, beta member 1
Organism
rno  Rattus norvegicus (rat)
Brite
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  K+ channel, KCNA, Kv1.x (Shaker)
   29737 (Kcnab1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
2q31
AA seq 401 aa AA seqDB search
MQVSIACTEHNLKSRNGEDRLLSKQSSTAPNVVNAARAKFRTVAIIARSLGTFTPQHHIS
LKESTAKQTGMKYRNLGKSGLRVSCLGLGTWVTFGGQISDEVAERLMTIAYESGVNLFDT
AEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLSRKHIIEGLKGSLQR
LQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSAMEIMEAYSVARQFN
MIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLACGIISGKYGNGVPESSRAS
LKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAWCLRNEGVSSVLLGSST
PEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDYRS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtctccatagcctgcacagagcacaatttgaagagtcgaaatggtgaggaccga
cttctgagcaagcagagctccaccgcccccaatgtggtgaacgcagcccgggccaaattc
cgcactgtcgctatcatcgctcgcagcctggggaccttcacccctcagcatcacatttct
ctcaaagagtccactgcaaagcagactggcatgaaatataggaatcttgggaaatcagga
ctcagagtttcgtgcttgggtcttggaacatgggtgacattcggaggtcaaatttcagat
gaggttgctgaacggctgatgacaattgcctatgagagtggagttaatctcttcgacact
gcagaagtctatgctgctgggaaggctgaggtgattctggggagcatcatcaagaagaaa
ggctggaggaggtcaagcttggtcatcacaaccaaactctactggggtggaaaagccgaa
acagaaagaggattgtcaagaaagcacatcattgaaggactgaaaggctccctccagagg
ctgcaactggaatatgtggacgtggtctttgcaaatcgcccagacagcaacacccccatg
gaagaaatcgttcgagccatgacgcacgtgatcaaccaaggcatggcaatgtactggggc
acctcgaggtggagcgcgatggagatcatggaagcctactctgtcgcgcggcagttcaac
atgatcccgcctgtctgtgagcaagctgagtatcatcttttccagagagaaaaggtggag
gtccagctgccagagctctaccataaaataggggttggtgcaatgacatggtctccactt
gcttgtggaattatttcaggaaaatatggaaatggggtgccagaaagttctagagcttca
ctgaagtgctaccagtggttgaaggaaaggattgtaagtgaagaagggagaaaacagcaa
aacaagctgaaagacctctctccaattgctgaacgcctgggatgcacactacctcagctg
gctgtggcatggtgcctgagaaacgagggtgtgagctctgtgctgctgggatcatccact
cctgaacaactcattgaaaaccttggtgccattcaggtcctccctaagatgacatcacat
gtggtaaatgagattgataacatattgcgcaacaagccctacagcaaaaaggactataga
tcctaa

DBGET integrated database retrieval system