KEGG   Rattus norvegicus (rat): 29747Help
Entry
29747             CDS       T01003                                 

Gene name
Kcnmb1
Definition
potassium large conductance calcium-activated channel, subfamily M, beta member 1
Orthology
K04937  
potassium large conductance calcium-activated channel subfamily M beta member 1
Organism
rno  Rattus norvegicus (rat)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Insulin secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    29747 (Kcnmb1)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    29747 (Kcnmb1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    29747 (Kcnmb1)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  K+ channel, KCNM, KCa1.x
   29747 (Kcnmb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q12
AA seq 191 aa AA seqDB search
MGKKLVMAQKRGETRALCLGVAMVVCAAITYYILGTTVLPLYQKSVWTQESTCHLVETNI
KDQEELEGRKVPQYPCLWVNVSAVGRWAMLYHTEDTRDQNQQCSYIPRNLDNYQTALVDV
KKVRANFYKHHNFYCFSAPQVNETSVVYQRLYGPQILLFSFFWPTFLLTGGLLIIAMVKL
NRSLSVLAAQK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagctggtgatggcccagaagcgcggagagactcgagccctctgcctgggg
gtggcgatggtcgtgtgtgccgccatcacttactacatcctgggtaccactgtgctgccc
ctctaccagaaaagtgtgtggacccaggaatccacctgtcacttggttgaaaccaacatc
aaggaccaggaagagctggagggcaggaaggtgccccagtacccatgcctttgggtcaat
gtatcagctgtgggcagatgggccatgctgtatcacacagaagacactcgggatcaaaac
caacagtgctcctatatccccaggaacctggacaactaccagacagccttggttgatgtg
aagaaggtcagagccaatttctacaaacaccataatttctattgcttttctgcacctcaa
gtcaatgagaccagtgttgtgtaccagcgcctctatgggccccaaatcctcctcttctcc
ttcttctggcccaccttcctgctgactggtggccttcttatcattgccatggtaaagctc
aacaggtccctctctgtcttggcagctcagaagtag

DBGET integrated database retrieval system