KEGG   Rattus norvegicus (rat): 29749Help
Entry
29749             CDS       T01003                                 

Gene name
Ppp3r2, Cblp
Definition
(RefSeq) protein phosphatase 3, regulatory subunit B, beta
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04020  Calcium signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04310  Wnt signaling pathway
rno04360  Axon guidance
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04625  C-type lectin receptor signaling pathway
rno04650  Natural killer cell mediated cytotoxicity
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04662  B cell receptor signaling pathway
rno04720  Long-term potentiation
rno04724  Glutamatergic synapse
rno04921  Oxytocin signaling pathway
rno04922  Glucagon signaling pathway
rno04924  Renin secretion
rno05010  Alzheimer's disease
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05031  Amphetamine addiction
rno05152  Tuberculosis
rno05166  HTLV-I infection
rno05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    29749 (Ppp3r2)
   04310 Wnt signaling pathway
    29749 (Ppp3r2)
   04370 VEGF signaling pathway
    29749 (Ppp3r2)
   04020 Calcium signaling pathway
    29749 (Ppp3r2)
   04022 cGMP - PKG signaling pathway
    29749 (Ppp3r2)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    29749 (Ppp3r2)
   04218 Cellular senescence
    29749 (Ppp3r2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    29749 (Ppp3r2)
   04650 Natural killer cell mediated cytotoxicity
    29749 (Ppp3r2)
   04660 T cell receptor signaling pathway
    29749 (Ppp3r2)
   04658 Th1 and Th2 cell differentiation
    29749 (Ppp3r2)
   04659 Th17 cell differentiation
    29749 (Ppp3r2)
   04662 B cell receptor signaling pathway
    29749 (Ppp3r2)
  Endocrine system
   04922 Glucagon signaling pathway
    29749 (Ppp3r2)
   04921 Oxytocin signaling pathway
    29749 (Ppp3r2)
   04924 Renin secretion
    29749 (Ppp3r2)
  Nervous system
   04724 Glutamatergic synapse
    29749 (Ppp3r2)
   04720 Long-term potentiation
    29749 (Ppp3r2)
  Development
   04360 Axon guidance
    29749 (Ppp3r2)
   04380 Osteoclast differentiation
    29749 (Ppp3r2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    29749 (Ppp3r2)
   05014 Amyotrophic lateral sclerosis (ALS)
    29749 (Ppp3r2)
  Substance dependence
   05031 Amphetamine addiction
    29749 (Ppp3r2)
  Infectious diseases
   05152 Tuberculosis
    29749 (Ppp3r2)
   05166 HTLV-I infection
    29749 (Ppp3r2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    29749 (Ppp3r2)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     29749 (Ppp3r2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 29749
NCBI-ProteinID: NP_067733
RGD: 69232
Ensembl: ENSRNOG00000005368
UniProt: P28470
Position
5q22
AA seq 176 aa AA seqDB search
MGNEASYHSEMGTHFDHDEIKRLGRSFKKMDLDKSGSLSVDEFMSLPELQQNPLVGRVID
IFDTDGNGEVDFREFIVGTSQFSVKGDEEQKLRFAFRIYDMDNDGFISNGELFQVLKMMV
GNNLKDWQLQQLVDKSILVLDKDGDGRISFEEFRDVVRTMEIHKKLVVFVDHGQED
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaggccagttaccattctgagatgggcacccacttcgaccacgacgagatt
aaaaggctgggcagaagcttcaagaagatggacttggacaaatcgggctccctgagcgta
gacgagttcatgtcgctgcctgagctgcagcagaatccactggtgggccgagtgatcgac
atctttgacacagacggcaacggggaagtggacttccgcgagttcatcgtgggcacctcc
cagttcagcgtcaagggtgacgaagagcagaagctaaggttcgccttcagaatctatgac
atggataatgatggcttcatctccaacggggagctcttccaggtgcttaagatgatggtg
ggaaacaacctcaaggactggcagctgcagcagctggtggacaaaagcatcttggtcctg
gataaggatggtgatggccggatatcctttgaagagttccgtgatgtggtcagaaccatg
gagatccacaagaaattggtcgtgtttgtagatcacggtcaagaagactaa

DBGET integrated database retrieval system