KEGG   Rattus norvegicus (rat): 297893Help
Entry
297893            CDS       T01003                                 

Gene name
Hdac1
Definition
histone deacetylase 1 (EC:3.5.1.98)
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
rno  Rattus norvegicus (rat)
Pathway
Cell cycle
Notch signaling pathway
Thyroid hormone signaling pathway
Huntington's disease
Amphetamine addiction
Alcoholism
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:rno04330]
Cellular Processes; Cell growth and death; Cell cycle [PATH:rno04110]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:rno04919]
Human Diseases; Cancers; Pathways in cancer [PATH:rno05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:rno05202]
Human Diseases; Cancers; Viral carcinogenesis [PATH:rno05203]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:rno05220]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:rno05016]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:rno05031]
Human Diseases; Substance dependence; Alcoholism [PATH:rno05034]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:rno05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q36
AA seq 482 aa AA seqDB search
MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
MA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaagaggaaagtctgttactactacgacggggatgttgga
aactactattatggacaagggcacccaatgaagcctcaccgaatccgaatgactcataat
ttgctgctcaactatggtctctaccgaaaaatggaaatctatcgtcctcacaaagccaac
gctgaggagatgaccaagtaccacagcgacgactacatcaagttcttgcgttctattcgc
ccagacaatatgtctgaatacagcaagcagatgcagagattcaacgtgggtgaggactgt
ccggtatttgatggcttgtttgagttctgtcagttgtccacgggtggctctgtcgcgagt
gctgtgaaactcaataagcagcagacggacatcgctgtgaactgggctgggggcctgcac
catgcgaagaagtctgaagcatccggcttctgttacgtcaatgatattgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgacattcaccatggc
gatggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataaa
tacggagagtacttcccaggaactggggacctacgggatattggggctggcaaaggcaag
tactacgccgttaactacccactgcgagatggcattgatgatgagtcctatgaagccatc
tttaagccagtcatgtccaaagtaatggagatgttccagcctagtgcagtggtcctacag
tgcggctcagactccctgtctggggatcggctaggttgcttcaatctgaccatcaaagga
catgccaagtgtgtggagttcgtgaagagtttcaacttgccgatgctaatgttgggagga
ggtggctataccatccgtaatgtcgctcggtgctggacttacgagacagctgtggccctg
gacacagagatccctaatgagctaccatacaatgactactttgaatactttggaccagat
ttcaagcttcacatcagcccttccaatatgactaaccagaacactaatgaatacctggag
aagatcaagcagcggctctttgagaacttgagaatgctgccccatgcccctggggtccaa
atgcaggccatcccagaggatgccatcccagaagagagcggtgatgaggatgaggaagac
cctgacaaacgaatttccatctgctcctctgacaaacgcattgcctgtgaggaggaattc
tctgattctgatgaggagggagaaggaggtcgcaagaactcttctaacttcaaaaaagcc
aaaagagtcaaaacagaagatgaaaaagaaaaagatcccgaggagaaaaaagaagtcaca
gaagaggagaaaaccaaggaggagaagccagaagccaaaggggtcaaagaagaggtcaag
atggcctga

DBGET integrated database retrieval system