KEGG   Rattus norvegicus (rat): 297893Help
Entry
297893            CDS       T01003                                 

Gene name
Hdac1
Definition
histone deacetylase 1 (EC:3.5.1.98)
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
rno  Rattus norvegicus (rat)
Pathway
Cell cycle
Notch signaling pathway
Thyroid hormone signaling pathway
Huntington's disease
Amphetamine addiction
Alcoholism
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    297893 (Hdac1)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    297893 (Hdac1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    297893 (Hdac1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    297893 (Hdac1)
   05202 Transcriptional misregulation in cancers
    297893 (Hdac1)
   05203 Viral carcinogenesis
    297893 (Hdac1)
   05220 Chronic myeloid leukemia
    297893 (Hdac1)
  Neurodegenerative diseases
   05016 Huntington's disease
    297893 (Hdac1)
  Substance dependence
   05031 Amphetamine addiction
    297893 (Hdac1)
   05034 Alcoholism
    297893 (Hdac1)
  Infectious diseases
   05169 Epstein-Barr virus infection
    297893 (Hdac1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     297893 (Hdac1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q36
AA seq 482 aa AA seqDB search
MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
MA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaagaggaaagtctgttactactacgacggggatgttgga
aactactattatggacaagggcacccaatgaagcctcaccgaatccgaatgactcataat
ttgctgctcaactatggtctctaccgaaaaatggaaatctatcgtcctcacaaagccaac
gctgaggagatgaccaagtaccacagcgacgactacatcaagttcttgcgttctattcgc
ccagacaatatgtctgaatacagcaagcagatgcagagattcaacgtgggtgaggactgt
ccggtatttgatggcttgtttgagttctgtcagttgtccacgggtggctctgtcgcgagt
gctgtgaaactcaataagcagcagacggacatcgctgtgaactgggctgggggcctgcac
catgcgaagaagtctgaagcatccggcttctgttacgtcaatgatattgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgacattcaccatggc
gatggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataaa
tacggagagtacttcccaggaactggggacctacgggatattggggctggcaaaggcaag
tactacgccgttaactacccactgcgagatggcattgatgatgagtcctatgaagccatc
tttaagccagtcatgtccaaagtaatggagatgttccagcctagtgcagtggtcctacag
tgcggctcagactccctgtctggggatcggctaggttgcttcaatctgaccatcaaagga
catgccaagtgtgtggagttcgtgaagagtttcaacttgccgatgctaatgttgggagga
ggtggctataccatccgtaatgtcgctcggtgctggacttacgagacagctgtggccctg
gacacagagatccctaatgagctaccatacaatgactactttgaatactttggaccagat
ttcaagcttcacatcagcccttccaatatgactaaccagaacactaatgaatacctggag
aagatcaagcagcggctctttgagaacttgagaatgctgccccatgcccctggggtccaa
atgcaggccatcccagaggatgccatcccagaagagagcggtgatgaggatgaggaagac
cctgacaaacgaatttccatctgctcctctgacaaacgcattgcctgtgaggaggaattc
tctgattctgatgaggagggagaaggaggtcgcaagaactcttctaacttcaaaaaagcc
aaaagagtcaaaacagaagatgaaaaagaaaaagatcccgaggagaaaaaagaagtcaca
gaagaggagaaaaccaaggaggagaagccagaagccaaaggggtcaaagaagaggtcaag
atggcctga

DBGET integrated database retrieval system