KEGG   Rattus norvegicus (rat): 298376Help
Entry
298376            CDS       T01003                                 

Gene name
Gpx7
Definition
glutathione peroxidase 7 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Thyroid hormone synthesis
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rno00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:rno00480]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:rno04918]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q35
AA seq 186 aa AA seqDB search
MVAAVATAWLLLWAAACTQSEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTD
QNYRALQQLQRDLGPYHFNVLAFPCNQFGQQEPDSNREIENFARRTYSVSFPMFSKIAVT
GTGAHPAFKYLTQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVPVEEIKPRITEQVMKLIL
QKREDL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggttgcggctgtggcgacggcgtggctgctcctgtgggccgcggcctgcacgcaatcc
gagcaagacttctacgacttcaaggcggtgaacatccggggcaagctggtgtcgctggag
aagtaccgcggctcggtttccctggtggtgaatgtagctagcgaatgtggcttcacagac
cagaactaccgagccttgcagcagctgcagcgggacctgggcccctaccattttaacgtg
cttgctttcccttgcaaccagtttggccaacaggaaccagacagcaacagggagattgag
aactttgcccgccgcacctacagtgtctctttccccatgtttagcaagatcgcagtcact
ggcactggtgcccaccctgccttcaaatacctaacccaaacttctgggaaggagcccacc
tggaacttctggaagtacctagtggccccagacggaaaggtggtgggggcatgggatccc
actgtgccggtggaggagatcaagccccgtattacagagcaggtgatgaagctcatcctt
cagaaacgagaagacttgtga

DBGET integrated database retrieval system