KEGG   Rattus norvegicus (rat): 298399Help
Entry
298399            CDS       T01003                                 

Gene name
Gba2
Definition
glucosidase beta 2 (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
rno  Rattus norvegicus (rat)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    298399 (Gba2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    298399 (Gba2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     298399 (Gba2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q22
AA seq 904 aa AA seqDB search
MVTCVPASEQIGCAERDSQIYSEDTGGTEAVRVTDCRSPEDSGPQNEPGYCNSEDSGQLM
ASYEGKARGYQVPPFGWRICLAHEFAEKRKPFQANNVSLSNLVKHFGMGLRYLKWWYRKT
QVEKKTPFIDMFNSVPLRQIYGCPLGGIGGGTITRGWRGQFCRWQLNPGMYQHQTVIADQ
FIVCLRRDGRTVYQQVLSLELPSVLRSWNWGLCGYFAFYHALYPRAWTVYQLPGQNVTLT
CRQITPILPHDYQDSSLPVGVFVWDVENEGDETLDVSIMFSMRNGLGGEDDAAGGLWNEP
FRLEQDGTTVQGLLLHHPTPPNPYTMAVAARHTADTTVTYTTAFDPDSTGQQVWQDLLQD
GQLDSPAGQSTPTQRGEGVAGAVCASSKLLPRGRCCLEFSLAWDMPRIMFGAKGQVHYRR
YTRFFGSDGDVAPALSHYALCQYAGWENSISAWQNPVLDDRSLPAWYKSALFNELYFLAD
GGTVWLEVPEDSLPEELGGSMYQLRPILQDYGRFGYLEGQEYRMYNTYDVHFYASFALVM
LWPKLELSLQYDMALATFKEDLTRRRYLMSGVVAPVKRRNVIPHDIGDPDDEPWLRVNAY
LIHDTADWKDLNLKFVLQVYRDYYLTGDQGFLKDMWPVCLAVMESEMKFDKDQDGLIENG
GYADQTYDGWVTTGPSAYCGGLWLAAVAVMVQMAVLCGAQDVQDKFSSILCRGREAYERL
LWNGRYYNYDSSSQPQSRSVMSDQCAGQWFLRACGLGEGDTEVFPTLHVVRALKTIFELN
VQAFAGGAMGAVNGMQPHGVPDRSSVQSDEVWVGVVYGLAATMIQEGLTWEGFRTAEGCY
RTVWERLGLAFQTPEAYCQQRVFRSLAYMRPLSIWAMQLALQQQQHKKNSSRPAVTQGTA
PSTA
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atggtaacctgcgtacctgcctccgagcagatcggctgtgcggaaagagattcacaaatt
tatagtgaagatactggaggcactgaggctgtgcgggttacagactgccggagcccggag
gacagtggaccccagaatgagccaggctactgcaattcagaggactctgggcagctgatg
gcctcctacgagggtaaagctaggggctaccaggtgcctccttttggctggcggatttgc
ttggctcacgagtttgcagagaagaggaaaccttttcaggctaacaacgtctctctcagt
aatttggtaaagcatttcggtatgggcttgaggtacttgaagtggtggtaccggaagacg
caggtggaaaagaagacccctttcatcgacatgttcaattctgtacccctgagacagatc
tacggttgccccttgggtggcattggaggaggcaccatcacccggggctggagaggccag
ttctgtcgttggcagcttaatcctggaatgtaccagcaccagacagtcattgcagaccaa
tttatagtatgcttgcgtcgagatgggcggactgtgtatcagcaagtcctgtccttggag
cttccgagtgtcctgcgcagctggaactggggcctgtgtggttattttgctttctaccac
gccctctatccccgagcctggacagtctatcagcttcctggccagaatgtcaccctcacc
tgtcgccagatcacacctatcttgcctcatgattaccaggacagcagcctccccgtagga
gtgtttgtgtgggatgtagagaatgaaggagatgagactctggatgtgtccatcatgttc
tccatgcggaatggactaggaggtgaagatgatgctgccggaggtttgtggaacgagccc
ttccgtctggaacaggatgggacgactgtacaggggctactcctgcatcatccaacccct
ccgaacccctacaccatggctgtggctgcgcgacacacggcagataccacagtaacctac
accacagcctttgaccccgacagcactgggcagcaggtgtggcaggacctacttcaagat
ggacagctggactcccctgctggccagagcaccccgacacagagaggagagggtgtcgct
ggggctgtatgtgcctccagcaagctgctgccacgaggccggtgctgcttggagttctca
ctggcttgggatatgcctaggatcatgtttggagccaaaggccaagtccactacaggcgg
tatacacggttctttggttcagatggtgatgtggcgcctgccctgagccactatgccctg
tgccagtatgcaggttgggagaacagcatctcagcgtggcagaacccagtactggacgac
agatccttgcctgcctggtacaaatctgcactgttcaatgaactatacttcctggctgat
ggaggcacggtgtggctggaagttcctgaagactccctaccagaggagctgggagggagt
atgtaccagctgcgccctattctgcaggactatgggcgatttggctatctcgaaggccag
gagtaccgcatgtacaacacatacgatgtccacttctacgcttcttttgctctcgtcatg
ctgtggcccaaacttgagctcagtcttcagtatgatatggctctggcaactttcaaggag
gacctgacacggcgacggtacctgatgagtggagtagtggcgcctgtgaaaaggaggaac
gttatccctcatgatattggggatccagatgatgagccatggctccgggtcaacgcatat
ttgatccatgatactgctgactggaaggacctgaacctgaagtttgtgttgcaagtttat
cgggactattacctgacaggcgatcaaggcttcctgaaggacatgtggcctgtgtgtctg
gctgtgatggagtccgaaatgaagtttgataaggaccaagatggactcattgagaatgga
ggctatgcagaccagacctacgatggatgggtcaccacaggccccagtgcttactgcgga
gggctgtggctggcagctgtggctgtgatggtccagatggccgttctgtgtggggcccag
gatgtccaggataagttttcttccattctctgccgaggccgggaagcttatgagagattg
ctctggaacggacgctattacaactacgacagcagctcccagccacagtcccgcagcgtc
atgtctgaccagtgtgctgggcagtggttcctgagggcctgcggcctgggagaaggagac
actgaagtattccctaccctgcatgttgtccgtgctctcaaaaccatctttgagctcaat
gtccaagccttcgcaggaggagccatgggggctgtgaatgggatgcagcctcatggtgtc
cctgataggtccagtgtgcagtctgatgaagtttgggtgggcgtggtctatgggctggca
gccaccatgatccaagagggcctgacttgggaaggtttccggacagctgaaggctgttac
cgcactgtatgggaacgcctgggcctggctttccagaccccagaggcatactgccagcag
cgagtgttccgctccctggcctacatgcggcccctgagcatctgggccatgcagctggcc
cttcaacagcagcagcataaaaagaacagcagccggccagcagtcacacaaggcacagca
cccagcacagcctga

DBGET integrated database retrieval system