KEGG   Rattus norvegicus (rat): 298575Help
Entry
298575            CDS       T01003                                 

Gene name
Pink1
Definition
(RefSeq) PTEN induced putative kinase 1 (EC:2.7.11.1)
  KO
K05688  
PTEN induced putative kinase 1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Parkinson's disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    298575 (Pink1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     298575 (Pink1)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: Other group
  NKF2 family
   298575 (Pink1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    298575 (Pink1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q36
AA seq 257 aa AA seqDB search
MAVRQALGRGLQLGRALLLRFAPKPGPVSGWGKPGPGAAWGRGERPGRVSSPGAQPRPLG
LPLPDRYRFFRQSVAGLAARIQRQFVVRARGGAGPCGRAVFLAFGLGLGLIEEKQAESRR
AASACQEIQAIFTQKNKQVSDPLDTRRWQGFRLEDYLIGQAIGKGCNAAVYEATMPTLPQ
HLEKAKHLGLLGKGPDVVSKGADGEQAPGAPAFPFAIKMMWNISAGSSSEAILSKMSQEL
EALGSANRKGTLQQFRR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgcgacaggcactgggccgaggcctgcagctgggtcgggcgctgctgctgcgc
ttcgctcccaagccgggcccggtgtcaggctggggcaagcccggccccggtgcggcctgg
ggccgcggagagcgtcccggccgggtctcaagcccgggagcacagccgcgtccgctcggg
ctccccctcccggaccgctaccgcttcttccgccagtcggtggctgggctggcggcgcga
atccagcggcagttcgtggtgcgggcccgaggcggcgcagggccttgcggccgagcagtc
ttcctggccttcggactggggttggggctgatcgaggagaagcaggcggagagccggagg
gccgcctcggcctgtcaggagatccaggcaatttttacacagaaaaacaagcaagtgtct
gacccactggacacacgacgttggcagggcttccgcctggaggattatctgataggacag
gccatcggcaagggctgcaatgccgctgtgtatgaagccaccatgcccacactgccccag
cacctggagaaggccaaacaccttggccttctaggaaaaggcccagatgtcgtctcaaag
ggagcagatggggagcaggctccaggggcccccgccttcccctttgccatcaaaatgatg
tggaatatctcggcaggatcctccagcgaagccatcttaagcaaaatgagccaggagctg
gaagccttgggttcagcaaacaggaagggcacccttcaacagttcaggcggtag

DBGET integrated database retrieval system