KEGG   Rattus norvegicus (rat): 298595Help
Entry
298595            CDS       T01003                                 

Gene name
Padi6, RGD1560424
Definition
peptidyl arginine deiminase, type VI (EC:3.5.3.15)
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
rno  Rattus norvegicus (rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q36
AA seq 683 aa AA seqDB search
MSFQSTLSLSLDSPTHAICMVGMEITLDISGCAPDKCESFTIRGSPRVLIHISSSVITGK
EDAVVWRPMKQPTEALVRMVSPSPTVDEDKVLVSYYCPDKEVPTATAVLFLTGIEVSLEA
DIYRDGQLDMPSDKQAKKRWMWGLNGWGAILLVNCNPETPSQSDEQSGAQESPREIQNLS
QMTLTVEGPTSILRDYQLLLHTSKEEAKKTRVYWAHRGASAYELVVGPDKPFHILPTFDT
RGKETFYIEATEFPSPSFSGLISFSVSLIEQAHDQLIPETPLYKDTVMFRVAPYIFLPST
QLPLEVYLCRELQLQGFVDSVTKLSEKSNVQVASVYEDPNRQGRWLQDEMAFCYTQAPHK
TLSFILDTPRVAKLEDFPMKYSLSPGVGYLIQETEDHRVASLDSVGNLIVSPPVKAQGKD
YPLGRILIGGSFYPSFEGRDMSKALRDFVYAQQVQAPVELFSDWLMTGHVDQFLCFVPVD
DKNSDRKGFRLLLASPSACYELFEQKQKEGFGDVTLFEDVRAEQLISNGREVKTISQILA
DENLREQNAYVEKCISLNRTLLKKELGLVDNDFIRIPQLFCLEPLTNVPSNQQTSKLFAR
PYFPDMLQMIVLGKNIGIPKPFGPQIKGTCCLEETVCGLLEPLGLKCTFIDDFDCYLANI
GDACASVIVNRVPFAFKWWKMNP
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttcagagtactctcagcctgtctctggacagccccacccatgctatctgcatg
gtgggtatggaaatcaccttggacatcagtgggtgcgccccagataagtgtgagtccttc
accatccgtggctcccccagggtcttgatccacatctccagctccgtcattaccgggaag
gaggatgctgtggtctggcggccaatgaaacaacccacagaggcactggtgaggatggtg
tcacccagccccactgtggacgaagacaaggtgctggtctcctactactgtcctgacaaa
gaggtccccacggccacagctgtgctgttcctcactggtattgaggtctccctggaggca
gacatctatcgggatggacaactggacatgccaagtgataaacaagctaagaaaagatgg
atgtggggtctgaacggctggggagccatcctgctcgtgaattgtaatcctgaaacccca
agccagtctgatgagcagtccggggctcaggagagccccagagaaatacagaacctgtct
cagatgacgctaactgtggagggccccaccagcatccttcgggactaccagttgcttcta
catacctccaaggaagaggcgaagaagacaagagtctactgggctcacaggggcgcctct
gcctatgaactggtagtaggacctgacaaacctttccacatcctgcctacctttgacacc
cgtgggaaagagactttctacatagaagccacagagttcccatctcccagcttctctggc
ctgatctccttctcggtctccctaatagaacaggctcatgaccagttgatcccagagacc
ccgctatataaggatacagtgatgttccgggtggcaccttacatcttcctgcccagtacc
cagctgcctctagaggtttacctgtgccgggagctacagctgcaaggctttgtggactcc
gtgacaaagctgagtgagaagagcaacgtgcaggtggcatccgtctatgaggaccccaac
cgccagggcaggtggctacaggacgagatggctttctgctatacgcaggctcctcacaag
actctgtccttcatccttgacaccccgagggttgccaagctggaagatttccccatgaaa
tactcactgagccctggcgttggctacctgatccaagaaactgaggaccaccgggtggct
agcctggattccgtcgggaacctgattgtatccccgcctgtcaaggctcagggcaaagac
tacccactaggaaggattctcattggtggcagcttttaccccagctttgagggccgggac
atgagcaaggccctacgagacttcgtgtacgcccaacaggtgcaggcccctgtggagctc
ttctcggattggctgatgaccggtcacgtggatcagttcctatgctttgtccctgtcgat
gataagaacagtgacaggaagggcttccgcctgctgctggccagtcccagtgcctgctat
gagctctttgaacagaagcagaaggagggctttggggacgtgacgctgttcgaagatgtc
agagcagaacagctcatttctaatgggagggaggtcaaaaccatctcccaaatcctggct
gatgagaatttgcgagagcagaacgcctatgtggagaagtgcatcagcctgaaccgcacc
cttctgaagaaggaactgggactggtggacaatgacttcatcaggatcccacagctcttc
tgcctggagccgctgacaaacgtcccctccaaccagcagacctcaaaactctttgcaagg
ccttacttccccgacatgctgcagatgatcgtgctaggcaagaacattgggatccccaag
cccttcgggccccaaatcaagggcacctgctgcctggaagagacggtctgtggcttactg
gagcccctgggtctcaagtgcaccttcattgatgactttgactgctacttggccaacata
ggggacgcctgtgccagtgtcatcgtaaaccgggtgccatttgcattcaagtggtggaag
atgaacccataa

DBGET integrated database retrieval system