KEGG   Rattus norvegicus (rat): 298607Help
Entry
298607            CDS       T01003                                 

Gene name
Agmat
Definition
agmatine ureohydrolase (agmatinase) (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rno00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q36
AA seq 353 aa AA seqDB search
MLQLLKSSWVRSAGSGVVTWRASAGLFCPGTRQASDTSDTLHHPSPSSESQVQPVRVCSM
MHLPLQSSPEGLDAAFVGVPLDTGTSNRPGARFGPRRIREESLMLGTVNPSTGALPFQSL
RVADLGNVNVNLYNLQDSCRLIREAYQNILATGCIPLTLGGDHTITYPILQAVAKEHGPV
GLVHVGAHSNTSDKPLEDKVYHRTPFRRSVDEGLLDSKRVVQIGIRGSSRTLDPYRYSRS
QGFRVVLAEDCWMKSLVPLMAEIRQQMGGVPLYISFAIDALDPAYAPGTGTPEIAGLTPS
QALEIIRGCQGLNVVGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTV
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagctgctgaagtccagctgggtccggagtgcggggtctggggtggtcacgtgg
cgtgcctctgcggggctcttctgtcctgggacccgccaggcttcagatacctcagatacc
ctacatcacccgtcccctagctctgagtcacaggtacagccggtacgcgtctgttccatg
atgcacttgcccctgcagtcctcccccgaggggctggatgctgctttcgtcggtgtgcct
ctggataccggaacttccaaccggcccggggcaagatttggaccccgtcgcatccgggag
gagtcactgatgctggggactgtcaatcccagcacgggagccctccccttccagtccctc
agggttgcagacctaggcaatgtgaacgtcaatctctacaaccttcaggacagctgccgg
ctaatccgagaggcctatcagaacatcctagcaactggctgcattcctctgaccttgggt
ggagaccataccatcacatatcccatactgcaagccgtggcaaaagagcatggccctgtg
ggtttagtgcatgtgggtgcccacagcaacacctcggacaaacctctggaggacaaggtc
taccatcggacacctttccgccgaagtgtggatgagggactgctggacagcaagcgagtg
gtacagataggtatccggggctcctccaggaccctggatccctacagatacagtcggagc
cagggcttccgtgtggtcctggctgaagactgttggatgaagtcactggtccccctgatg
gcagagatcaggcagcagatggggggtgtgcctctttacatcagctttgccatagatgcc
ttggatcctgcctatgccccagggacagggacaccagaaattgctgggctcacccctagt
caggctctggagatcatccggggctgtcaaggcctgaatgtggtgggctgtgaccttgtg
gaagtttccccgccgtatgatctctctggaaacacagccctcctcgcggctaacctactg
tttgagatgctgtgtgctctccccaaggtgacaactgtctga

DBGET integrated database retrieval system