KEGG   Rattus norvegicus (rat): 298908Help
Entry
298908            CDS       T01003                                 

Gene name
Kcnf1, Kh1, Kv5.1
Definition
(RefSeq) potassium voltage-gated channel modifier subfamily F member 1
  KO
K04899  
potassium voltage-gated channel subfamily F member 1
Organism
rno  Rattus norvegicus (rat)
Brite
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  K+ channel, KCNF, Kv5.x
   298908 (Kcnf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q16
AA seq 505 aa AA seqDB search
MEPGLASEPTRSMDASAEQSLPEPGSQDSVAGDDIEIVVNVGGVRQVLYGDLLSQYPETR
LAELINCLAGGYDTIFSLCDDYDPGKREFYFDRDPDAFKCVIEVYYFGEVHMKKGICPIC
FKNEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDAAEGRWRRCQKCV
WKFLEKPESSCPARVVAVLSFLLILVSSVVMCMGTIPELQVVDSEGNRVEHPTLENVETA
CIGWFTLEYLLRLFSSPNKLHFALSFMNIVDVLAILPFYVSLTLTHLGARMMELTNVQQA
VQALRIMRIARIFKLARHSSGLQTLTYALKRSFKELGLLLMYLAVGIFVFSALGYTMEQS
HPETLFKSIPQSFWWAIITMTTVGYGDIYPKTTLGKLNAAISFLCGVIAIALPIHPIINN
FVRYYNKQRVLETAAKHELELMELNSSSAESKPGGSRSDLDTLPPEPAAREGPSWGSRLK
LSHSDTFIPLLTEEKHHRTRLQSCK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggaaccggggcttgcaagcgaacccaccaggagcatggacgcatctgcggagcaaagc
ctcccagagccaggcagccaggactctgtggcaggcgatgacattgagatcgtggtaaat
gtggggggcgtgcggcaggtgctctatggagacctgctcagccagtatcccgagacgcgg
ctggcagagctcatcaactgcttggcggggggctacgacaccatcttctctctgtgcgat
gattacgacccaggcaagcgcgaattctactttgatcgggacccggacgcgttcaagtgt
gtcattgaagtatactatttcggtgaggtccacatgaagaaaggcatctgccctatctgc
ttcaagaacgagatggacttctggaaggtggacctcaaattcctggatgactgttgcaag
agccatctgagtgagaagcgcgaggaactggaggaaatcgcgcgcagggtgcagctcatc
ttggacgacctgggtgtagacgctgccgagggccgctggcgccgctgccagaagtgtgtc
tggaagttcctggagaagccggagtcttcgtgcccagcgcgggtggtggcagttctatcc
tttttgctcatccttgtctcctccgtggtcatgtgcatgggcaccatacctgagctgcaa
gtggtggactctgaaggcaaccgcgtagagcacccgacgctggagaacgtggagactgct
tgcatcggctggttcactctggagtacctgctgcgcctcttctcatcgcccaacaagctg
cactttgccctgtccttcatgaacattgtggatgtgctggccattctccccttctatgtg
agcctcacactcacgcatctgggtgcaagaatgatggaactgaccaacgtgcagcaggct
gtgcaggccctaaggatcatgcgcatcgcacgcatcttcaagctagcccgccactcctca
ggcctgcagaccctcacctacgctctcaagcgcagtttcaaggaactggggctattgctt
atgtacctggccgtgggcatcttcgtcttctccgcactaggctacaccatggagcagagc
caccctgaaactctgttcaagagcatcccccagtccttctggtgggctatcatcaccatg
accacagtgggctatggcgacatctaccccaagaccactctgggcaagctcaacgcggcc
atcagcttcttgtgtggggtaattgccattgccttgcccattcaccccatcattaacaac
tttgtcaggtactacaacaaacaacgtgtcctggagacggcagccaagcatgagctggag
ctgatggagctcaactccagcagcgcagaaagcaagcccgggggctctcgcagcgacctg
gacaccctgcccccagagcctgctgccagggaggggccaagttggggtagccggctgaag
ctctcacacagcgataccttcattcccctgctgacagaggagaagcatcataggacccgg
ctacagagctgcaagtga

DBGET integrated database retrieval system