KEGG   Rattus norvegicus (rat): 298934Help
Entry
298934            CDS       T01003                                 

Gene name
Adi1, Alp1, Fe-ARD, MTCBP-1, Ni-ARD
Definition
acireductone dioxygenase 1 (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
rno  Rattus norvegicus (rat)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:rno00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q16
AA seq 179 aa AA seqDB search
MVQAWYMDESTADPRMPHRAQPDRPVGLEQLRTLGVLYWKLDADKYENDPELEQIRKTRN
YSWMDIITICKDSLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISME
KGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRAAXHFDARVQYVKFLEGTA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggcctggtatatggacgagtccacggccgacccgcggatgccccaccgcgca
cagcccgaccgccctgtgggactggagcagctgcgcacgctcggagtgctctattggaag
ctagatgcggacaagtatgagaatgatccagaactggaacagattcggaaaacaaggaac
tactcatggatggatatcatcaccatatgcaaagattcacttcccaattatgaggagaag
atcaagatgttctttgaggaacatctgcatctggatgaggagatccgctacatcctggag
ggcagcgggtacttcgatgtcagggacaaggaggacaagtggatccggatttctatggag
aagggggacatgatcacgcttcctgccggcatttatcaccgcttcacgctggacgagaag
aactacgtgaaggccatgcggctgtttgttggagaacctgtatggacaccatacaaccgg
gcagctgavcattttgatgcccgggtacagtacgtgaagtttttggaaggaacagcatag

DBGET integrated database retrieval system