KEGG   Rattus norvegicus (rat): 298934Help
Entry
298934            CDS       T01003                                 

Gene name
Adi1, Alp1, Fe-ARD, MTCBP-1, Ni-ARD
Definition
(RefSeq) acireductone dioxygenase 1 (EC:1.13.11.54)
  KO
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
rno  Rattus norvegicus (rat)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    298934 (Adi1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     298934 (Adi1)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     298934 (Adi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q16
AA seq 179 aa AA seqDB search
MVQAWYMDESTADPRMPHRAQPDRPVGLEQLRTLGVLYWKLDADKYENDPELEQIRKTRN
YSWMDIITICKDSLPNYEEKIKMFFEEHLHLDEEIRYILEGSGYFDVRDKEDKWIRISME
KGDMITLPAGIYHRFTLDEKNYVKAMRLFVGEPVWTPYNRAAXHFDARVQYVKFLEGTA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaggcctggtatatggacgagtccacggccgacccgcggatgccccaccgcgca
cagcccgaccgccctgtgggactggagcagctgcgcacgctcggagtgctctattggaag
ctagatgcggacaagtatgagaatgatccagaactggaacagattcggaaaacaaggaac
tactcatggatggatatcatcaccatatgcaaagattcacttcccaattatgaggagaag
atcaagatgttctttgaggaacatctgcatctggatgaggagatccgctacatcctggag
ggcagcgggtacttcgatgtcagggacaaggaggacaagtggatccggatttctatggag
aagggggacatgatcacgcttcctgccggcatttatcaccgcttcacgctggacgagaag
aactacgtgaaggccatgcggctgtttgttggagaacctgtatggacaccatacaaccgg
gcagctgavcattttgatgcccgggtacagtacgtgaagtttttggaaggaacagcatag

DBGET integrated database retrieval system