KEGG   Rattus norvegicus (rat): 298947Help
Entry
298947            CDS       T01003                                 

Gene name
Pik3cg, Pi3k
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
rno  Rattus norvegicus (rat)
Pathway
Inositol phosphate metabolism
cGMP-PKG signaling pathway
Phospholipase D signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Platelet activation
Cholinergic synapse
Oxytocin signaling pathway
Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    298947 (Pik3cg)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    298947 (Pik3cg)
   04072 Phospholipase D signaling pathway
    298947 (Pik3cg)
   04022 cGMP - PKG signaling pathway
    298947 (Pik3cg)
   04151 PI3K-Akt signaling pathway
    298947 (Pik3cg)
 Organismal Systems
  Immune system
   04611 Platelet activation
    298947 (Pik3cg)
  Endocrine system
   04921 Oxytocin signaling pathway
    298947 (Pik3cg)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    298947 (Pik3cg)
  Nervous system
   04725 Cholinergic synapse
    298947 (Pik3cg)
 Human Diseases
  Infectious diseases
   05145 Toxoplasmosis
    298947 (Pik3cg)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     298947 (Pik3cg)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    298947 (Pik3cg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
UniProt: 
Position
6q16
AA seq 1102 aa AA seqDB search
MELENYEQPVVLREDNLRRRRRMKPRSAAGSLSSMELIPIEFVLPTSQRISKTPETALLH
VAGHGNVEQMKAQVWLRALETSVAAEFYHRLGPDQFLLLYQKKGQWYEIYDRYQVVQTLD
CLRYWKMMHKSPGQIHVVQRHVPSEETLAFQKQLTSLIGYDVTDISNVHDDELEFTRRRL
VTPRMAEVAGRDAKLYAMHPWVTSKPLPDYLSKKIVNNCIFIVIHRGTTSQTIKVSADDT
PDTILQSFFTKMAKKKSLMNIPESQSEQDFVLRVCGRDEYLVGETPLKNFQWVRQCLKNG
EEIHLVLDTPPDPALDEVRNEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKLFTEEVLWNVWLEFGIKI
KDLPKGALLNLQIYCCKTPSLSSKASVETPGSESKGKAQLLYYVNLLLIDHRFLLRHGGY
VLHMWQISGKAEEQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHRPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWGQ
QEIVAKTYQLLARREIWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGKAMLQDFTQQVHVIEMLQKVTIDIKSLSAEKYDVSSQVISQLKQKLESLQNSSLP
ESFRVPYDPGLKAGTLVIEKCKVMASKKKPLWLEFKRADPTVLSNETIGIIFKHGDDLRQ
DMLILQILRIMESIWEAESLDLCLLPYGCISTGDKIGMIEIVKDATTIAQIQQSTVGNTG
AFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDVCVRAYLAL
RHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALMVGRSEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt NT seq  +upstreamnt  +downstreamnt
atggagctggagaactatgaacaacctgtggttctgagagaggacaacctccgcaggcgc
cggaggatgaagccacgcagcgcagcaggcagcctgtcttccatggagctcatccccatt
gagttcgtactgcccaccagccagcgcatcagcaagacaccggaaacggccctgctgcat
gtggctggccacggcaatgtggagcagatgaaagctcaggtgtggttacgcgcactggag
accagtgtggctgcggaattctaccaccgattaggtccggaccaattcctcctcctctac
cagaagaagggacagtggtatgagatctacgataggtaccaagtggtgcagaccctagac
tgcctacgttactggaagatgatgcacaagagccccggccagatccacgtggtacagcga
catgtaccttctgaggagaccctggctttccagaagcagctcacctccctgattggctac
gacgtcactgacatcagcaacgtgcacgatgatgagctagaattcactcgccgccgtctg
gttacgccccgcatggctgaagtggctggccgggatgccaaactctatgccatgcaccct
tgggtgacctccaaacctcttccagactacctgtcaaaaaaaattgtcaacaattgcatt
ttcattgtcatccatcgtggtaccaccagtcaaaccatcaaggtctccgcagatgatact
cctgacaccatccttcagagcttcttcaccaagatggccaagaagaagtccctaatgaat
atcccagaaagtcaaagtgagcaggattttgtgctgcgggtctgtggccgtgatgagtac
ctagtaggtgaaacgcccctcaaaaatttccagtgggtgaggcagtgcctcaagaacgga
gaggaaatacacctggtgctcgacacgcctccagacccggccctagatgaggtgaggaac
gaagaatggccgctggtggatgactgcactggagtcaccggctaccatgagcagctgacc
atccatggcaaggaccacgagagcgttttcacagtgtctttgtgggactgtgaccgaaag
ttcagggtcaagatcagaggcattgatatccctgtcttgcctcggaacaccgacctcact
gtttttgtggaagcaaatatccagcatgggcaacaagtcctctgccaaaggagaaccagc
cctaagctcttcacagaagaggtgctctggaatgtgtggctggagtttggcattaaaatc
aaagacttgcccaaaggggccctactgaacctacagatctactgctgcaaaaccccatca
ctgtccagtaaggcttccgtagagacgccaggctccgagtccaagggcaaagcccagctc
ctctattacgtgaacttgctgttgatagaccaccgcttcctcctccgccatgggggctac
gtgctccacatgtggcagatatctgggaaggcagaggaacagggcagcttcaatgccgac
aagctcacctccgcaaccaatcctgacaaggagaactcaatgtccatttccatcttgctg
gacaactactgtcaccccattgctttgcctaagcaccggcctactccggacccagaagga
gacagagttcgagctgaaatgcccaatcagcttcgaaagcaattggaggcaatcatagcc
acagatccacttaaccccctcacagcagaggacaaagaattgctctggcattttagatat
gaaagcctgaagcatccaaaggcataccctaaactattcagctcagtaaagtggggacag
caagaaattgttgccaaaacataccagctattagccagaagggagatctgggatcaaagt
gctttggatgttggcttaaccatgcaactcctggactgcaacttttcagatgaaaacgta
agggccattgcagttcagaaactggagagcttggaggacgatgacgttttacattacctt
ctccagctggtgcaggctgtgaaatttgaaccataccatgacagtgcgctggccagattc
ttgctgaagcgtggcttgagaaacaagagaattggtcacttcttattctggttcttgcga
agtgagatagcccagtccagacactatcagcagaggttcgctgtgatcctggaagcgtac
ctgcgcggctgtggcaaggccatgctacaggacttcacgcagcaggtccacgtgattgag
atgttacagaaagtcaccattgatatcaaatcactctcggctgagaagtatgatgtcagt
tcccaagttatttcacagcttaagcaaaagcttgaaagcctgcagaattccagtcttcct
gagagctttagagttccctatgatcctggactgaaagcaggtaccctggtgattgagaag
tgtaaagtgatggcctccaagaagaagcccctgtggcttgagtttaaacgtgccgatcct
acagtcctatccaatgaaaccattgggatcatctttaaacatggcgacgatctacgccaa
gacatgttgatcttacagattctacgcatcatggagtccatttgggaggctgaatctctg
gacctgtgccttctgccttacggttgcatctcaactggtgacaaaatagggatgatagag
attgtgaaggacgccacgacgattgctcaaattcagcagagcacggtgggtaacacgggg
gcattcaaagatgaagtcctgaatcactggctcaaggaaaaatgccctattgaagaaaag
tttcaggcagcagtggaaaggttcgtttactcctgtgcaggctactgtgtggccacattt
gttcttgggataggtgacaggcacaacgacaacatcatgatctcagagacaggaaaccta
tttcacatagactttggacacattcttggcaattacaagagtttcctgggcatcaataaa
gagagagtaccttttgtcctaaccccggacttcttgtttgtgatgggaacttcgggcaaa
aagacaagtccacacttccagaaattccaggatgtctgcgttagggcttacctagctctt
cgccaccacacaaacctgctgatcatcctgttctccatgatgctgatgacaggaatgccg
cagctgacaagcaaagaggacattgaatacatccgggatgccctcatggtggggagaagc
gaggaggacgccaagaagtatttccttgatcagattgaagtctgcagggacaaaggatgg
actgtgcagtttaactggttcctccatcttgttcttggcatcaagcaaggagagaaacac
tccgcttga

DBGET integrated database retrieval system