KEGG   Rattus norvegicus (rat): 299012Help
Entry
299012            CDS       T01003                                 

Gene name
Arhgap5, LRRGT00098
Definition
Rho GTPase activating protein 5
Orthology
K13709  
Rho GTPase-activating protein 5
Organism
rno  Rattus norvegicus (rat)
Pathway
Focal adhesion
Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    299012 (Arhgap5)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    299012 (Arhgap5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q23
AA seq 1245 aa AA seqDB search
MAKNKEPRPPSYTVSVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTID
FGGRVVNNDHFLYWGDITQNGEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAAA
SKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFVN
NLFVQLSKSKKPVIIAATKCDECVDHYLREVQAFASNKKNLLVVETSARFNVNIETCFTA
LVQMLDKTRGKPKIIPYLDAYKTQRQLVVTATDKFEKLVQTVRDYHATWKTVSNKLKNHP
DYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYISTLPRAFNTLLPDLEEIEHLNW
LEALKLMEKRADFQLCFVVLEKTPWDETDHIDKINDRRIPFDLLSTLEAEKVYQNHVQHL
ISEKRRIEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAFKYITEADSKEVYGRHQRE
IVEKAKEEFQEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRESL
LLKHIGFVYHPTKETCLSGQYCTDIKVENLLANSLLHSDHNRSRLYHDSTNIDKVNLFIL
GKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYILSQLWTAAFKPHGCFCV
FNSIESLSFIGEFIGKIRTEASQIRKDKYMANLPFTLILANQRDSISKNLPILRHQGQQL
ANKLQCPFVDVPAGTYPRKFNESQIKQALRGVLESVKHNLDVVSPVPINKDVSEADLRIV
MCAMCGDPFSVDIILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQITILSYHSSIG
VRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKELM
TEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSDNTRESTHQS
EDVFLPSPRDCFPYNNYPDSDDDTEAPPPYSPIGDDVQLLPTPSDRSRYRLDLEGNEYPV
HSTPNCHDHERNHKVPPPIKPKPVVPKTNVKKLDPNLLKTIEAGIGKNPRKQTSRVPLAH
PEDMDSSDNYAEPLDTIFKQKGYPDEIYVVPDDSQNRIIKIRNSFVNNTQGDEENGFSDR
TSKGHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFPTSKTKRKGRHRGSEEDPL
LSPVETWKGGIDNPAITSDQEVDDKKIKKKPHKVKEDKKGFVSKG
NT seq 3738 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaacaaagagcctcgacccccatcctatactgtcagtgtggttggactctct
gggactgaaaaagacaaaggaaactgtggagttggaaaatcttgtttgtgcaatagattt
gtacgttcaaaagcagatgaatattatccagagcatacttctgtgcttagcaccattgac
tttggaggacgagtagtaaacaatgatcactttttatactggggtgacataacacaaaat
ggtgaagatggagtagaatgcaaaattcatgtcattgaacaaacagagttcattgatgat
cagactttcttgcctcatcgaagtacaaatttgcaaccatacataaaacgtgcagctgcc
tctaaattgcagtcagcagaaaaactgatgtacatttgcaccgatcagctaggcttggag
caagactttgaacagaagcagatgcctgaagggaaactcaatgtagatggatttttattg
tgtattgatgtgagtcaaggatgtaataggaagtttgatgatcaacttaaatttgtgaat
aacctttttgtccagctatcaaaatccaaaaagcctgtgataatagcagcaactaaatgt
gatgaatgtgtggatcattaccttagagaagttcaagcctttgcttcaaacaaaaagaac
cttctagtagtggaaacatcagcacgatttaatgtcaacattgagacatgtttcactgct
ttggtacaaatgttggataaaactcgtggcaaacctaaaattattccctatctggatgct
tataaaacacagagacaacttgttgtcacagcaacagacaagtttgaaaaacttgtacag
actgtgagagattatcatgcaacttggaaaactgttagtaataaattaaaaaaccaccct
gattatgaagaatatatcaacttagagggaacaagaaaggccagaaatacattttcaaag
catatagagcaactcaaacaggaacatataagaaaaaggagagaagaatatataagtacc
ttaccaagggcttttaatactctcttgccagatctagaagagattgaacatttgaattgg
ttggaagctttgaagttaatggaaaagagagcagatttccagttatgttttgtggtgcta
gaaaaaacaccttgggatgaaactgaccatatagacaaaattaatgatagacggatccca
ttcgaccttctgagcactttagaagcagaaaaggtctatcaaaaccatgtacaacatctg
atatcagagaaaagaagaatagaaatgaaggagaaattcaagaagactttagaaaaaatt
cagttcatttcacctgggcagccgtgggaggaagttatgtgttttgtcatggaggatgaa
gcattcaaatacatcactgaggctgatagcaaagaagtatatggtagacatcagcgagag
atagtagaaaaagccaaagaagagtttcaggaaatgctttttgagcattctgaacttttt
tatgatttagatcttaatgcaacaccaagttctgataaaatgagtgaaattcatacagtt
ctaagtgaagaacctagatataaagctttacagaaacttgcacctgatagagaatctctt
ctccttaagcacataggattcgtttatcatcccactaaagaaacatgcctcagtggccaa
tactgtacagacattaaagtggaaaacttacttgccaatagtctattacattcggatcat
aaccgctcacgcttgtatcatgatagtaccaatatagacaaagttaatcttttcatttta
gggaaagatggccttgcccaggaactagcaaatgagataaggactcaatccactgatgat
gagtatgccttagatggaaaaatttatgaacttgatcttcggcctgttgatgccaaatcg
ccttacattttgagtcagctatggactgcagcctttaaaccacatgggtgcttctgtgta
tttaattccatcgagtcactgagttttattggggagtttattggaaaaataagaactgaa
gcatctcagatcagaaaagataaatatatggctaatcttccatttacattaattcttgct
aatcagagagattccattagtaaaaatctaccaattctcaggcatcaaggtcaacagttg
gccaataaattgcagtgtcctttcgtcgacgtacctgctggtacgtatcctcgtaaattc
aatgaatcacaaataaagcaagctctacgaggagtattagaatcagttaaacacaattta
gatgtggtgagcccagttcctatcaataaggatgtgtcagaagctgacttgagaattgtc
atgtgtgccatgtgtggcgatccttttagtgtggatattattctttcacctttccttgac
tctcattcttgcagtgctgctcaagctggacagaataattcattaatgcttgacaaaatt
attggtgaaaaaaggaggcgaatacagatcacaatattgtcataccactcctcaattgga
gtaagaaaagatgaactagttcatgggtatatattagtttattctgcaaaaaggaaagca
tcaatgggaatgcttcgtgcatttctatcagaagttcaagataccattcctgtacaactg
gtggcagttactgacagtcaagctgatttttttgaaaatgaagctatcaaggagttaatg
actgaaggagaacacattgcaactgagataactgctaaatttacagcattatattcttta
tctcagtatcataggcaaactgaggtttttactttgtttttcagtgacgttctagagaaa
aaaaatatgatagaaaattcctatttgtctgataatacaagggaatccactcatcaaagt
gaagatgtttttcttccgtctccaagagactgctttccctacaacaactacccagattca
gatgatgacacagaagcaccacctccatatagtccaattggggatgatgtacagttgctt
ccaacacctagtgaccgttccagatacaggttagatttggaaggaaatgagtatcctgtt
catagcactccaaattgtcacgatcatgagcgtaaccataaagtgcctccacctattaaa
cctaaaccagtcgttcctaaaacaaatgtgaaaaaactggatccaaacctattaaaaacg
attgaagctggtattggtaaaaatccaagaaaacagacttctcgggtgcctttggcacat
cctgaagatatggattcctcagataactatgcggaaccccttgacacaatttttaagcag
aagggctatcctgatgagatttatgttgtcccagatgatagtcagaatcgaattattaaa
attcgaaactcatttgtaaataacactcaaggagatgaagaaaatgggttttctgataga
acctcaaaaggtcatggggaacgtaggccttcaaaatacaagtataagtctaaaactctg
tttagtaaagccaagtcatactatagaagaacacactcagatgcaagcgatgatgaggct
ttccctacttctaaaacaaaaagaaaaggaaggcatcgtggaagtgaagaagatccatta
ctttctcctgttgaaacttggaaaggtggtattgataatcctgcaatcacatctgaccag
gaggtagatgataagaagataaagaagaaaccccacaaagtaaaagaagataaaaagggt
tttgttagcaaaggctag

DBGET integrated database retrieval system