KEGG   Rattus norvegicus (rat): 299201Help
Entry
299201            CDS       T01003                                 

Gene name
Dlst
Definition
(RefSeq) dihydrolipoamide S-succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00020  Citrate cycle (TCA cycle)
rno00310  Lysine degradation
rno01100  Metabolic pathways
rno01200  Carbon metabolism
Module
rno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rno_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    299201 (Dlst)
  Amino acid metabolism
   00310 Lysine degradation
    299201 (Dlst)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     299201 (Dlst)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-GeneID: 299201
NCBI-ProteinID: NP_001006982
RGD: 1359615
Ensembl: ENSRNOG00000005061
UniProt: Q01205 G3V6P2
Position
6q31
AA seq 454 aa AA seqDB search
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPDSRKMVINNSSVFSVRF
FQTTAVCKNDVITVQTPAFAESVTEGDVRWEKAVGDAVAEDEVVCEIETDKTSVQVPSPA
NGIIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPATAHKAAPEAPAAPPPPVAP
VPTQMPPVPSPSQPPSSKPVSAIKPTAAPPLAEAGAAKGLRSEHREKMNRMRQRIAQRLK
EAQNTCAMLTTFNEVDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVKASAFALQEQPVVN
AVIDDATKEVVYRDYIDISVAVATPRGLVVPVIRNVETMNYADIERTINELGEKARKNEL
AIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAVGGKVEVRPMMYVA
LTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccggtcccgctgcgtgtcccgggcgttcagccgctcgctttctgccttccag
aaggggaactgccctctagggagacgttccctgcctggggtctccttatgtcagggacca
ggttaccctgacagcaggaagatggtcattaacaacagtagcgtcttcagtgttcgcttc
ttccaaaccacggcagtgtgcaagaatgatgtgattacagtccagaccccagcgtttgca
gagtctgtcacagagggagatgtcaggtgggagaaagctgttggagatgcagttgcagaa
gatgaagtggtgtgtgagattgagacagacaagacttctgtgcaggttccatcaccagca
aatggcatcattgaagctcttttggtacccgatgggggcaaagttgaaggaggaactcct
ctattcacactcaggaaaaccggtgctgctcctgctaaggccaaaccagctgaagcccct
gctacagcccacaaagcagcgcctgaagcaccggcggcccctcctcctcctgtagcacca
gtgcccactcagatgccacctgtgccctcaccctcacaacctccttctagcaaaccagtg
tctgcaataaaacccactgctgcccctccactggctgaggcgggagctgctaaaggcctg
cgctcagaacatcgggaaaagatgaacaggatgcggcagcgcatcgcccagcgtctgaag
gaagcccagaacacctgcgcaatgctgacgacgttcaatgaggttgacatgagtaacata
caagagatgagagctcggcacaaagatgctttcctgaaaaaacataacctgaaattaggc
ttcatgtcggcatttgtgaaggcctcagcattcgccttgcaggagcagcctgtagtaaac
gcagtgattgatgacgcaaccaaggaggtggtgtacagagattatattgacatcagtgtc
gcagttgctaccccaaggggtctcgtggttcctgtcatcaggaatgtggaaactatgaat
tatgcagatattgaacggaccattaatgaactaggagagaaggcccggaagaatgaactt
gccatcgaagacatggatgggggcaccttcaccatcagcaatggaggagttttcggctca
cttttcggaacacccattatcaacccgcctcagtctgccattctgggcatgcatggcatc
ttcgacaggcctgtggctgtggggggcaaggtggaagtccgacctatgatgtatgtagcc
ctgacctacgaccaccggctgattgatggcagagaggctgtgactttcctccgaaaaatc
aaggcagcagtagaagatccacgagtcctcctcctagacctttag

DBGET integrated database retrieval system