KEGG   Rattus norvegicus (rat): 299201Help
Entry
299201            CDS       T01003                                 

Gene name
Dlst
Definition
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rno  Rattus norvegicus (rat)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    299201 (Dlst)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    299201 (Dlst)
  Amino acid metabolism
   00310 Lysine degradation
    299201 (Dlst)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     299201 (Dlst)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q31
AA seq 454 aa AA seqDB search
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPDSRKMVINNSSVFSVRF
FQTTAVCKNDVITVQTPAFAESVTEGDVRWEKAVGDAVAEDEVVCEIETDKTSVQVPSPA
NGIIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPATAHKAAPEAPAAPPPPVAP
VPTQMPPVPSPSQPPSSKPVSAIKPTAAPPLAEAGAAKGLRSEHREKMNRMRQRIAQRLK
EAQNTCAMLTTFNEVDMSNIQEMRARHKDAFLKKHNLKLGFMSAFVKASAFALQEQPVVN
AVIDDATKEVVYRDYIDISVAVATPRGLVVPVIRNVETMNYADIERTINELGEKARKNEL
AIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAVGGKVEVRPMMYVA
LTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccggtcccgctgcgtgtcccgggcgttcagccgctcgctttctgccttccag
aaggggaactgccctctagggagacgttccctgcctggggtctccttatgtcagggacca
ggttaccctgacagcaggaagatggtcattaacaacagtagcgtcttcagtgttcgcttc
ttccaaaccacggcagtgtgcaagaatgatgtgattacagtccagaccccagcgtttgca
gagtctgtcacagagggagatgtcaggtgggagaaagctgttggagatgcagttgcagaa
gatgaagtggtgtgtgagattgagacagacaagacttctgtgcaggttccatcaccagca
aatggcatcattgaagctcttttggtacccgatgggggcaaagttgaaggaggaactcct
ctattcacactcaggaaaaccggtgctgctcctgctaaggccaaaccagctgaagcccct
gctacagcccacaaagcagcgcctgaagcaccggcggcccctcctcctcctgtagcacca
gtgcccactcagatgccacctgtgccctcaccctcacaacctccttctagcaaaccagtg
tctgcaataaaacccactgctgcccctccactggctgaggcgggagctgctaaaggcctg
cgctcagaacatcgggaaaagatgaacaggatgcggcagcgcatcgcccagcgtctgaag
gaagcccagaacacctgcgcaatgctgacgacgttcaatgaggttgacatgagtaacata
caagagatgagagctcggcacaaagatgctttcctgaaaaaacataacctgaaattaggc
ttcatgtcggcatttgtgaaggcctcagcattcgccttgcaggagcagcctgtagtaaac
gcagtgattgatgacgcaaccaaggaggtggtgtacagagattatattgacatcagtgtc
gcagttgctaccccaaggggtctcgtggttcctgtcatcaggaatgtggaaactatgaat
tatgcagatattgaacggaccattaatgaactaggagagaaggcccggaagaatgaactt
gccatcgaagacatggatgggggcaccttcaccatcagcaatggaggagttttcggctca
cttttcggaacacccattatcaacccgcctcagtctgccattctgggcatgcatggcatc
ttcgacaggcctgtggctgtggggggcaaggtggaagtccgacctatgatgtatgtagcc
ctgacctacgaccaccggctgattgatggcagagaggctgtgactttcctccgaaaaatc
aaggcagcagtagaagatccacgagtcctcctcctagacctttag

DBGET integrated database retrieval system